close all open/close all

CDS information : Jado_00180


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction17,305 / 18,093 / + [in whole cluster]
122 / 910 / + [in contig]
Location17305..18093 [in whole cluster]
122..910 [in contig]
TypeCDS
Length789 bp (262 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productputative phosphopantetheinyl transferase
Product (GenBank)phosphopantetheinyl transferase
Gene
Gene (GenBank)jadM
EC number
Keyword
Note
Note (GenBank)
  • similar to HetI
Reference
ACC
PmId
[11390684] Cloning and functional analysis of a phosphopantetheinyl transferase superfamily gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2001)
Related Reference
ACC
Q9RFL1
NITE
Myxo_00010
PmId
[10601310] New lessons for combinatorial biosynthesis from myxobacteria. The myxothiazol biosynthetic gene cluster of Stigmatella aurantiaca DW4/3-1. (J Biol Chem. , 1999)
[11134965] The mtaA gene of the myxothiazol biosynthetic gene cluster from Stigmatella aurantiaca DW4/3-1 encodes a phosphopantetheinyl transferase that activates polyketide synthases and polypeptide synthetases. (J Biochem. , 2001)
Family/Domain
FD
IPR008278

close this sectionSequence

selected fasta
>putative phosphopantetheinyl transferase [phosphopantetheinyl transferase]
MPLLRVADDELHLWTLRPPPPGSAAADALATGELDGAERRRAEAYVRPRDRVQYLAAHLA
LRRVLARYTGVPAGRLRFGREAAGRPVLLGVAGPPSFSLSHSHGLVLLGVARRPVGVDVQ
RVPPYATAEVCRGALHPAEREELAALPEDRLAAAFARLWTRKEAYLKGLGTGLARGLATD
FLGTPGHGGVRRPAGWTVLDLPGGPDHAAAAALHGDTAPRVTTRALRPEDLTSTTHASHD
TQTPHDTYDPYDTQTERGVGSA
selected fasta
>putative phosphopantetheinyl transferase [phosphopantetheinyl transferase]
ATGCCGCTCCTGAGGGTCGCGGACGATGAGCTGCACCTCTGGACCCTCCGCCCGCCCCCG
CCGGGGTCCGCGGCCGCCGACGCCCTCGCGACCGGGGAACTCGACGGTGCCGAGCGGCGC
CGGGCGGAGGCGTACGTACGCCCCCGGGACCGGGTGCAGTACCTCGCGGCGCACCTCGCG
CTGCGCCGGGTCCTCGCCCGCTACACCGGAGTCCCGGCCGGGCGGCTGCGCTTCGGCCGT
GAGGCCGCCGGGCGGCCCGTGCTGCTCGGGGTGGCGGGACCGCCGTCCTTCTCGCTGTCG
CACAGCCACGGGCTGGTGCTGCTCGGGGTGGCCCGGCGGCCGGTGGGCGTCGACGTCCAG
CGCGTCCCGCCGTACGCCACCGCGGAGGTGTGCCGCGGCGCGCTCCACCCGGCCGAGCGG
GAGGAGCTCGCGGCCCTGCCGGAGGACCGTCTCGCGGCGGCCTTCGCCCGGCTGTGGACC
CGGAAGGAGGCCTACCTCAAGGGACTCGGCACGGGACTCGCGCGGGGCCTCGCCACCGAC
TTCCTCGGCACGCCGGGCCACGGCGGCGTCCGGCGGCCCGCCGGCTGGACGGTCCTCGAC
CTGCCGGGCGGACCCGACCACGCGGCGGCCGCCGCCCTGCACGGCGACACCGCGCCACGG
GTCACGACGAGGGCCCTGCGCCCCGAGGACCTGACCAGCACCACACACGCATCGCACGAC
ACGCAGACACCGCACGACACGTACGACCCGTACGACACGCAGACCGAAAGGGGAGTGGGA
AGCGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [11-119]  1.3e-27 SSF56214 [113-235]  1.3e-23 SSF56214
SSF56214   4'-phosphopantetheinyl transferase
 [114-178]  1.1e-09 G3DSA:3.90.470.20
G3DSA:3.90.470.20   no description
 [114-176]  8.7e-13 PF01648
PF01648   ACPS
SignalP
 [1-24]  0.119 Signal
Bacteria, Gram-negative   
 [1-25]  0.246 Signal
Bacteria, Gram-positive   
TMHMM No significant hit