close all open/close all

CDS information : Jado_00190


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction18,094 / 19,671 / + [in whole cluster]
1 / 1,578 / + [in contig]
Location18094..19671 [in whole cluster]
1..1578 [in contig]
TypeCDS
Length1,578 bp (525 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl-CoA carboxylase beta subunit
Product (GenBank)decarboxylase JadN
Gene
Gene (GenBank)jadN
EC number6.4.1.-
Keyword
Note
Note (GenBank)
  • similar to malonyl-CoA and propionyl-CoA decarboxylase
Reference
ACC
PmId
[11390684] Cloning and functional analysis of a phosphopantetheinyl transferase superfamily gene associated with jadomycin biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 2001)
Related Reference
ACC
O86517
PmId
[11526020] Role of an essential acyl coenzyme A carboxylase in the primary and secondary metabolism of Streptomyces coelicolor A3(2). (Appl Environ Microbiol. , 2001)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)
ACC
Q9X4K7
PmId
[10589718] Genetic and biochemical characterization of the alpha and beta components of a propionyl-CoA carboxylase complex of Streptomyces coelicolor A3(2). (Microbiology. , 1999)
[12048195] Kinetic and structural analysis of a new group of Acyl-CoA carboxylases found in Streptomyces coelicolor A3(2). (J Biol Chem. , 2002)

close this sectionSequence

selected fasta
>putative acyl-CoA carboxylase beta subunit [decarboxylase JadN]
MTTTSTAGGALADRLTELGRLRELAQEGPDPSGPPNASTAKGKLTARERIELLLDKGSFT
EIEQLRRHRAQGFGLEAKKPYTDGVITGWGTVEGRTVFVYAHDFRIFGGALGEAHATKIH
KIMDMAIAAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTRASGVIPQISVMLGPCAG
GAAYSPALTDFVFMVRETSQMFITGPDVVKAVTGEEITQNGLGGADVHAGVSGVSHFVYD
DEETCLAEVRYLLSMLPQNNRDLPPVMPSSDPADRPGDRLLDLVPADGNRSYDVREVIEE
LVDDSDYMEVHAAWAPNLVCAFARLDGHVVGIVANQPAAMAGVLDIKASEKGARFVQFCD
AFNIPIITLVDVPGFLPGVDQEHDGIIRRGAKLLYAYCNATVPRISVVLRKAYGGAYIVM
DSRSIGADISLAWPTNEIAVMGAEGAANVVFRREIAAADDPEAMRAQKIQEYREELVHPY
YAAERGLVDDVIDPRETRQVLCRSVAMLAAKHADLPRRKHGNPPQ
selected fasta
>putative acyl-CoA carboxylase beta subunit [decarboxylase JadN]
ATGACCACGACGTCCACGGCCGGAGGAGCCCTCGCGGACCGTCTCACCGAACTGGGCCGG
CTCCGGGAGCTCGCCCAGGAGGGCCCCGACCCCAGCGGGCCACCGAACGCCAGCACCGCG
AAGGGCAAGCTGACCGCCCGCGAGCGCATCGAACTGCTCCTGGACAAGGGGAGCTTCACG
GAGATCGAGCAGCTGCGGCGGCATCGTGCGCAGGGTTTCGGTCTGGAGGCGAAGAAGCCG
TACACCGATGGTGTGATCACCGGTTGGGGGACGGTGGAGGGCCGGACGGTCTTCGTGTAC
GCGCATGATTTCCGGATCTTCGGCGGGGCGCTGGGCGAGGCGCACGCGACGAAGATCCAC
AAAATCATGGACATGGCGATCGCGGCGGGTGCTCCGCTGGTCTCGCTGAACGACGGTGCG
GGTGCGCGTATCCAGGAGGGCGTCTCGGCGCTGGCCGGGTACGGCGGCATCTTCCAGCGC
AACACCCGGGCGTCGGGTGTGATCCCGCAGATCTCGGTGATGCTCGGCCCGTGCGCGGGC
GGCGCGGCCTACAGTCCGGCGCTGACGGACTTCGTGTTCATGGTCCGTGAGACCTCGCAG
ATGTTCATCACCGGTCCGGACGTCGTCAAGGCGGTCACCGGCGAGGAGATCACCCAGAAC
GGCCTCGGCGGCGCCGACGTCCACGCCGGCGTCTCCGGCGTCTCCCACTTCGTCTACGAC
GACGAGGAGACCTGCCTGGCCGAGGTCCGCTACCTGCTCTCGATGCTCCCGCAGAACAAC
CGCGACCTGCCGCCCGTCATGCCCAGCTCCGACCCCGCCGACCGGCCCGGCGACCGGCTG
CTCGACCTCGTCCCCGCCGACGGCAACCGCTCCTACGACGTCCGCGAGGTCATCGAGGAA
CTCGTCGACGACAGCGACTACATGGAGGTCCACGCGGCCTGGGCGCCCAATCTGGTGTGC
GCCTTCGCCCGGCTCGACGGGCACGTCGTCGGCATCGTCGCCAACCAGCCGGCCGCCATG
GCCGGGGTGCTCGACATCAAGGCCTCCGAGAAGGGGGCGCGCTTCGTGCAGTTCTGCGAC
GCCTTCAACATCCCGATCATCACCCTCGTCGACGTGCCCGGCTTCCTGCCCGGCGTCGAC
CAGGAGCACGACGGCATCATCCGGCGCGGCGCCAAGCTGCTCTACGCCTACTGCAACGCG
ACCGTGCCCCGGATCTCCGTCGTCCTGCGCAAGGCCTACGGCGGCGCCTACATCGTCATG
GACTCCCGCTCGATCGGCGCCGACATCTCCCTCGCCTGGCCCACCAACGAGATCGCGGTC
ATGGGCGCCGAAGGCGCCGCCAACGTGGTCTTCCGGCGGGAGATCGCCGCCGCCGACGAC
CCCGAGGCGATGCGGGCCCAGAAGATCCAGGAGTACCGCGAGGAGCTCGTGCACCCGTAC
TACGCCGCCGAGCGCGGCCTCGTCGACGACGTCATCGACCCGCGCGAGACCCGCCAGGTG
CTGTGCCGGTCCGTCGCCATGCTCGCCGCCAAGCACGCCGACCTGCCGCGCCGCAAGCAC
GGCAACCCGCCCCAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000022 Carboxyl transferase (Domain)
 [39-522]  PF01039
PF01039   Carboxyl_trans
IPR011762 Acetyl-coenzyme A carboxyltransferase, N-terminal (Domain)
 [18-232]  PS50980
PS50980   COA_CT_NTER
IPR011763 Acetyl-coenzyme A carboxyltransferase, C-terminal (Domain)
 [233-517]  PS50989
PS50989   COA_CT_CTER
SignalP
 [1-12]  0.081 Signal
Bacteria, Gram-negative   
TMHMM No significant hit