close all open/close all

CDS information : Jado_00200


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction19,940 / 20,458 / + [in whole cluster]
1,847 / 2,365 / + [in contig]
Location19940..20458 [in whole cluster]
1847..2365 [in contig]
TypeCDS
Length519 bp (172 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.3 uncharacterized protein (biosynthesis involved)
Productjadomycins binding protein
chloramphenicol binding protein
Product (GenBank)JadX
Gene
Gene (GenBank)jadX
EC number
Keyword
Note
Note (GenBank)
  • similar to MmyY
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
[26814718] JadX is a Disparate Natural Product Binding Protein. (J Am Chem Soc. , 2016)

close this sectionSequence

selected fasta
>jadomycins binding protein [JadX]
MTTTDLTAVTTTDGPALAAELAELRATVRELSDRAAISAVCDRYAMHLDKDRGSDDWFGA
VFTDDVHLVFPMGEYKGMDGLAAFQQMARTTFARTHHISGAYAIDLRGDEATVRAHLTAF
HVRDAAAPSAHFAIGGHYDAHVVRTPEGWRIRSFTFDLVWNAGEAPGAKGHS
selected fasta
>jadomycins binding protein [JadX]
ATGACCACCACCGACCTCACCGCCGTGACCACCACCGACGGACCGGCCCTCGCCGCCGAG
CTCGCCGAACTCCGCGCCACCGTCCGCGAGTTGTCCGACCGCGCCGCGATATCCGCGGTC
TGCGACCGCTACGCCATGCACCTCGACAAGGACCGGGGCAGCGACGACTGGTTCGGCGCG
GTGTTCACCGACGACGTCCACCTCGTCTTCCCGATGGGCGAGTACAAGGGCATGGACGGC
CTCGCCGCCTTCCAGCAGATGGCCCGCACGACCTTCGCCCGCACCCACCACATCAGCGGC
GCCTACGCGATCGACCTGCGCGGCGACGAGGCGACCGTACGGGCCCACCTCACCGCCTTC
CACGTCCGCGACGCCGCCGCGCCCTCCGCCCACTTCGCCATCGGCGGGCACTACGACGCC
CACGTCGTCCGCACCCCCGAGGGCTGGCGCATCCGCTCCTTCACCTTCGACCTGGTGTGG
AACGCCGGCGAGGCCCCCGGCGCGAAGGGCCACTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-35]  0.052 Signal
Bacteria, Gram-negative   
 [1-39]  0.051 Signal
Eukaryota   
TMHMM No significant hit