close all open/close all

CDS information : Jado_00210


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction20,458 / 21,882 / + [in whole cluster]
2,365 / 3,789 / + [in contig]
Location20458..21882 [in whole cluster]
2365..3789 [in contig]
TypeCDS
Length1,425 bp (474 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose 2,3-dehydratase
Product (GenBank)NDP-hexose 2,3-dehydratase
Gene
Gene (GenBank)jadO
EC number
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadO
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
Related Reference
ACC
Q9ALN6
NITE
Spino_00070
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase]
MSTGTTTPAPPSPPAGLAERIARSAATGRGAHLATEDFHDWLDGRRRANTFRVDKIPFDA
LDGWSFDEEDGNLVHRSGRFFTVEGLHVVEEDGPYGDGPYRSWYHPVIKQPEVGILGILA
KEFDGVLHFLMQAKMEPGNPNLLQLSPTVQATRSNYTKAHRGGDVKYIEYFTGAEHGTVI
ADSLQSEHGAWFFHKSNRNMIVEATGEVPLLDDFCWLTLGQLGELLHQDNVINMDARTVL
SCVPYEDADAGRALLSDVQLLSWFTGERSRHDVRARRVPLRELPGWKQGEETIEHEEGRH
FKVVAVSVQAGNREVTSWTQPLIEPVGLGVAAFLTRDFDGVPHYLVHARVEGGFLDTVEL
APTVQYTPGNYAHLPTDERPPFLDLVLDTDPGPRPATRPCTPRKAAAVSFKRREPLPSLV
EADETQGPGPDPAARATPGRPAAQLTSLAPGTGHYLNVQARTLLACVHAGAVRP
selected fasta
>putative NDP-hexose 2,3-dehydratase [NDP-hexose 2,3-dehydratase]
ATGAGCACCGGCACCACCACGCCCGCCCCGCCCTCACCGCCCGCCGGGCTCGCCGAGCGG
ATCGCCCGCTCGGCCGCCACCGGCCGCGGCGCCCACCTGGCCACCGAGGACTTCCACGAC
TGGCTCGACGGCCGCCGCCGCGCCAACACCTTCCGCGTCGACAAGATCCCCTTCGACGCG
CTCGACGGCTGGTCCTTCGACGAGGAGGACGGCAACCTCGTCCACCGCAGCGGCCGCTTC
TTCACCGTCGAGGGCCTGCACGTCGTCGAGGAGGACGGACCCTACGGCGACGGCCCGTAC
CGCTCCTGGTACCACCCCGTCATCAAGCAGCCCGAGGTCGGCATCCTCGGCATCCTCGCC
AAGGAGTTCGACGGCGTCCTGCACTTCCTCATGCAGGCCAAGATGGAGCCCGGCAACCCG
AACCTGCTCCAGCTGTCGCCGACCGTCCAGGCCACCCGCAGCAACTACACCAAGGCGCAC
CGCGGCGGCGACGTGAAGTACATCGAGTACTTCACCGGCGCCGAACACGGCACCGTCATC
GCCGACTCCCTCCAGTCCGAGCACGGCGCCTGGTTCTTCCACAAGTCCAACCGCAACATG
ATCGTCGAGGCCACCGGCGAGGTCCCGCTCCTCGACGACTTCTGCTGGCTCACCCTCGGC
CAGCTCGGCGAGCTCCTCCACCAGGACAACGTCATCAACATGGACGCCAGGACCGTCCTG
TCCTGCGTGCCGTACGAGGACGCCGACGCCGGGCGGGCGCTGCTCTCCGACGTCCAGCTG
CTCTCCTGGTTCACCGGCGAGCGCTCCCGCCACGACGTACGGGCCCGGCGCGTCCCGCTG
CGCGAGCTGCCCGGCTGGAAGCAGGGCGAGGAGACCATCGAGCACGAGGAGGGCCGGCAC
TTCAAGGTCGTCGCCGTCTCCGTGCAGGCCGGGAACCGCGAAGTGACCAGCTGGACCCAG
CCGCTGATCGAACCGGTCGGACTCGGCGTCGCCGCCTTCCTGACCCGCGACTTCGACGGC
GTCCCGCACTACCTGGTGCACGCCCGCGTCGAGGGCGGCTTCCTCGACACCGTGGAACTG
GCCCCCACCGTCCAGTACACCCCGGGCAACTACGCCCACCTGCCGACCGACGAGCGCCCG
CCCTTCCTCGACCTCGTCCTCGACACCGACCCCGGCCCGCGTCCGGCTACGAGGCCGTGC
ACTCCGAGGAAGGCGGCCGCGGTTTCCTTCAAACGCCGAGAGCCGCTACCTTCCTTGGTG
GAGGCCGACGAGACGCAAGGCCCCGGGCCGGACCCCGCCGCCCGGGCTACGCCTGGGCGA
CCCGCCGCACAGCTCACCTCCCTTGCACCCGGCACGGGCCACTACCTCAACGTCCAGGCC
CGCACCCTGCTGGCCTGCGTCCACGCCGGGGCGGTGCGGCCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [35-243]  2.99999999999998e-82 PF03559 [256-467]  1.5e-66 PF03559
PF03559   Hexose_dehydrat
SignalP No significant hit
TMHMM No significant hit