close all open/close all

CDS information : Jado_00220


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction21,912 / 22,910 / + [in whole cluster]
3,819 / 4,817 / + [in contig]
Location21912..22910 [in whole cluster]
3819..4817 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-3 ketoreductase
Product (GenBank)NDP-hexose 3-ketoreductase
Gene
Gene (GenBank)jadP
EC number
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadP
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
Related Reference
ACC
Q9ALN5
NITE
Spino_00080
PmId
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-hexose 3-ketoreductase]
MLGCADIAVRRMMPAMAALPGTEVTAVASRDAAKAAVAAAPYGAAAVEGYQELLRRPDVD
AVYVPLPAALHAEWTEAALRAGKHVLAEKPLTTDPESTAALLGLAAASGLALMETSCSST
TASTPTSRKLVADGAIGELRALHACSASPGCPTPTFRHDPGLGGGALGDVGVYPLRAAQH
LLGDELDVLGAHLVRGPGSRVETAGGALLATPAGVTAHIAFGMDHGYRSAYELWGSQGRL
VVERAYTPPADHRPVVRLETRTGVEALQKWVQGWFNLVLDADDQVRNTVAAFAALVARTG
AGHPGDGGAPDPEAPLRQARLLDAVRRRAALV
selected fasta
>putative NDP-hexose C-3 ketoreductase [NDP-hexose 3-ketoreductase]
GTGCTCGGCTGCGCCGACATCGCCGTCCGGCGCATGATGCCCGCGATGGCCGCGCTCCCC
GGGACCGAGGTCACCGCCGTCGCCAGCCGCGACGCGGCGAAGGCCGCCGTGGCCGCCGCC
CCGTACGGCGCGGCGGCCGTCGAGGGCTACCAGGAGCTGCTGCGCCGCCCGGACGTCGAC
GCCGTCTACGTACCGCTGCCCGCCGCCCTGCACGCCGAGTGGACCGAGGCCGCCCTGCGG
GCCGGCAAGCACGTCCTGGCCGAGAAGCCGCTCACCACGGACCCGGAGAGCACCGCCGCG
CTGCTCGGCCTGGCCGCCGCGTCCGGGCTCGCGCTGATGGAGACGTCATGTTCGTCCACC
ACCGCCTCCACACCGACGTCCCGCAAGCTCGTCGCGGACGGAGCCATCGGCGAACTCCGC
GCCCTGCACGCCTGTTCGGCATCCCCCGGCTGCCCGACACCGACATTCCGGCACGACCCC
GGGCTCGGCGGCGGCGCCCTCGGCGACGTCGGCGTCTACCCGCTGCGAGCCGCCCAGCAC
CTGCTCGGCGACGAACTCGACGTCCTCGGCGCGCACCTCGTCCGGGGGCCCGGCAGCCGG
GTCGAGACCGCCGGCGGGGCGCTGCTCGCCACCCCGGCGGGCGTCACCGCGCACATCGCC
TTCGGCATGGACCACGGCTACCGCTCGGCGTACGAGCTGTGGGGCAGCCAGGGCCGGCTC
GTCGTCGAGCGGGCCTACACCCCGCCCGCCGACCACCGCCCGGTGGTGCGCCTGGAGACC
CGCACCGGCGTCGAGGCGCTTCAGAAGTGGGTTCAAGGATGGTTCAACCTCGTCCTCGAC
GCCGACGACCAGGTCCGCAACACGGTGGCCGCCTTCGCCGCCCTCGTGGCGCGCACCGGA
GCCGGCCACCCCGGGGACGGCGGCGCGCCCGACCCGGAGGCCCCGCTGCGCCAGGCGCGG
CTGCTCGACGCCGTGCGGCGCCGGGCCGCCCTCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [1-113]  7.1e-25 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [128-232]  2e-09 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [1-137]  2.89999999999999e-36 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-35]  0.342 Signal
Bacteria, Gram-positive   
 [1-17]  0.566 Signal
Bacteria, Gram-negative   
TMHMM No significant hit