close all open/close all

CDS information : Jado_00230


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction23,016 / 23,915 / + [in whole cluster]
4,923 / 5,822 / + [in contig]
Location23016..23915 [in whole cluster]
4923..5822 [in contig]
TypeCDS
Length900 bp (299 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glucose-1-phosphate thymidylyltransferase
putative dTDP-glucose synthase
Product (GenBank)NDP-glucose phosphate nucleotidyltransferase
Gene
Gene (GenBank)jadQ
EC number2.7.7.24
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadQ
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
Related Reference
ACC
Q9AGY4
PmId
[12147463] Homologs of the Rml enzymes from Salmonella enterica are responsible for dTDP-beta-L-rhamnose biosynthesis in the gram-positive thermophile Aneurinibacillus thermoaerophilus DSM 10155. (Appl Environ Microbiol. , 2002)

close this sectionSequence

selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose phosphate nucleotidyltransferase]
MRLGTPEERTVKGIFLAGGHGTRLHPITLGTSKQMLPVYDKPMIYYPLSVLMLAGIRDIQ
IISSPDDIENFRRLLGDGSPLGISLSYAVQEQPRGLAEAFLISADHIGDDSVALVLGDNI
FHGPGFAGILQDKAVDVDGCVLFGYPVRDPERYGVGEVDADGRLVSLEEKPEHPRSDLAI
TGLYFYDNDVIDIAKNLTPSARGELEITDVNRIYLERGKAELVSLGRGFVWLDAGTHDAL
TEAGQYVQILEHRQGVRLACLEEIAWRMGFIDREACLRLGEELSKSPYGQYVMEIARAG
selected fasta
>putative glucose-1-phosphate thymidylyltransferase [NDP-glucose phosphate nucleotidyltransferase]
GTGAGGCTGGGAACCCCAGAGGAGAGAACTGTGAAAGGCATCTTCCTGGCCGGAGGCCAC
GGCACCCGGCTGCACCCGATCACCCTCGGCACGTCCAAGCAGATGCTGCCGGTCTACGAC
AAGCCGATGATCTACTACCCGCTCTCGGTGCTGATGCTCGCCGGGATCCGGGACATCCAG
ATCATCTCGTCCCCCGACGACATCGAGAACTTCCGCCGGCTGCTCGGCGACGGCTCCCCG
CTCGGCATCTCGCTCAGCTACGCCGTCCAGGAGCAGCCCCGCGGCCTCGCCGAGGCCTTC
CTCATCTCCGCCGACCACATCGGGGACGACTCCGTCGCCCTCGTCCTCGGCGACAACATC
TTCCACGGCCCCGGCTTCGCCGGAATCCTCCAGGACAAGGCCGTGGACGTGGACGGCTGC
GTGCTCTTCGGCTACCCGGTCCGCGACCCCGAGCGCTACGGCGTCGGCGAGGTCGACGCG
GACGGCCGGCTGGTCTCCCTGGAGGAGAAGCCGGAGCACCCGCGCTCCGACCTCGCCATC
ACCGGCCTCTACTTCTACGACAACGACGTCATCGACATCGCCAAGAACCTCACGCCCTCG
GCGCGCGGCGAACTGGAGATCACCGACGTCAACCGGATCTACCTGGAGCGCGGCAAGGCC
GAACTGGTGTCCCTGGGACGCGGGTTCGTCTGGCTCGACGCCGGAACGCACGACGCGCTG
ACCGAGGCCGGCCAGTACGTGCAGATCCTGGAGCACCGCCAGGGCGTCCGGCTCGCCTGC
CTCGAGGAGATCGCCTGGCGCATGGGGTTCATCGACCGGGAGGCCTGCCTGCGGCTCGGC
GAGGAGCTCTCGAAGTCCCCGTACGGCCAGTACGTCATGGAGATAGCCCGGGCCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005835 Nucleotidyl transferase (Domain)
 [12-246]  1.40000000000001e-59 PF00483
PF00483   NTP_transferase
IPR005907 Glucose-1-phosphate thymidylyltransferase, short form (Family)
 [12-296]  TIGR01207
TIGR01207   RmlA
SignalP No significant hit
TMHMM No significant hit