close all open/close all

CDS information : Jado_00240


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction23,966 / 25,156 / + [in whole cluster]
5,873 / 7,063 / + [in contig]
Location23966..25156 [in whole cluster]
5873..7063 [in contig]
TypeCDS
Length1,191 bp (396 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)glycosyltransferase
Gene
Gene (GenBank)jadS
EC number
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadS
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
[17570722] Stereochemical integrity of oxazolone ring-containing jadomycins. (Chembiochem. , 2007)
Related Reference
ACC
Q9F2F9
NITE
Ello_00180
PmId
[11306350] Identification of a sugar flexible glycosyltransferase from Streptomyces olivaceus, the producer of the antitumor polyketide elloramycin. (Chem Biol. , 2001)
[19233921] Modulation of deoxysugar transfer by the elloramycin glycosyltransferase ElmGT through site-directed mutagenesis. (J Bacteriol. , 2009)

close this sectionSequence

selected fasta
>putative glycosyltransferase [glycosyltransferase]
MRYLFTTIPGTSHTLPLVPLAHAALAAGHEVAFAASGPALRAANAAGLQTIAAAGDEAAE
PYEELIAKVTTSDLRRVPGPKILPYVSGIFGEVGARLVEGVAEAARTWRADAVVFPPNHV
AGLLAARMTGLPAVLHGIGTPRPVFAPALAYLEPVAARSASDLPAPVADVEIDLNPASLT
APSLGGPGGGGPAAAHRLPMRYTSYNGGAEIPPGLLGRGERPRVAVTLAPSPRCTARAPC
LREIVDGSADLGIELVITTGGAELPALTGSLPPHVTCVDWVPLRTLLASCDAIVHHGGMG
STFTAFDAGVPQLAIPLTGPESVSNGRVAADRGTGIVLDPPLSVPLTAATVKSSLHELLS
NPAHRTAAAEVAAEMREMPAPAATLVQLNALLGGTA
selected fasta
>putative glycosyltransferase [glycosyltransferase]
ATGCGATATCTGTTCACCACCATCCCGGGCACGTCCCACACGCTGCCCCTGGTCCCGCTC
GCCCACGCGGCGCTCGCCGCCGGGCACGAGGTCGCCTTCGCCGCCTCGGGCCCCGCCCTG
CGCGCGGCCAACGCCGCCGGTCTCCAGACCATCGCGGCCGCGGGCGACGAGGCCGCGGAG
CCGTACGAGGAGCTGATCGCCAAGGTCACCACGAGCGACCTGCGCAGAGTTCCCGGCCCG
AAGATCCTCCCGTACGTCTCCGGGATCTTCGGCGAGGTCGGCGCGCGTCTGGTGGAGGGC
GTCGCAGAGGCGGCCCGCACCTGGCGGGCCGACGCCGTGGTCTTCCCGCCCAACCACGTC
GCAGGACTGCTCGCCGCCCGGATGACCGGCCTGCCCGCCGTGCTGCACGGCATCGGCACC
CCCCGCCCGGTCTTCGCCCCGGCCCTCGCGTACCTGGAGCCGGTCGCCGCCCGCTCGGCG
TCTGACCTCCCGGCCCCGGTCGCCGACGTGGAGATCGACCTCAACCCGGCCTCCCTCACC
GCGCCGTCCCTCGGCGGCCCCGGCGGCGGCGGACCGGCCGCCGCGCACCGGCTCCCGATG
CGCTACACCTCGTACAACGGCGGCGCGGAGATCCCGCCCGGCCTGCTCGGCCGCGGCGAG
CGGCCCCGGGTCGCCGTGACGCTGGCTCCCTCGCCGCGCTGTACGGCGAGGGCACCATGC
CTCCGCGAGATCGTCGACGGCTCGGCGGACCTCGGCATCGAACTGGTCATCACCACCGGC
GGCGCCGAACTGCCCGCCCTCACCGGCTCGTTGCCCCCGCACGTCACCTGCGTGGACTGG
GTCCCGCTGCGCACCCTGCTCGCGAGCTGCGACGCGATCGTCCACCACGGCGGCATGGGC
AGCACCTTCACCGCCTTCGACGCCGGGGTCCCGCAGCTGGCGATCCCGCTCACCGGCCCG
GAGAGCGTCTCCAACGGCCGGGTCGCCGCCGACCGCGGCACCGGCATCGTCCTCGACCCG
CCGCTGTCCGTCCCGCTCACCGCCGCGACCGTGAAGTCCTCGCTGCACGAGCTGCTCAGC
AACCCCGCGCACCGCACGGCGGCCGCCGAAGTCGCCGCCGAGATGCGGGAGATGCCGGCG
CCCGCCGCCACCCTGGTCCAGCTCAACGCGCTCCTCGGAGGGACGGCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR010610 Domain of unknown function DUF1205 (Domain)
 [172-275]  2.90000000000001e-22 PF06722
PF06722   DUF1205
SignalP
 [1-34]  0.807 Signal
Bacteria, Gram-negative   
 [1-34]  0.943 Signal
Bacteria, Gram-positive   
 [1-26]  0.953 Signal
Eukaryota   
TMHMM No significant hit