close all open/close all

CDS information : Jado_00250


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction25,249 / 26,187 / + [in whole cluster]
7,156 / 8,094 / + [in contig]
Location25249..26187 [in whole cluster]
7156..8094 [in contig]
TypeCDS
Length939 bp (312 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative dTDP-glucose 4,6-dehydratase
Product (GenBank)NDP-hexose 4,6-dehydratase
Gene
Gene (GenBank)jadT
EC number4.2.1.46
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadT
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
Related Reference
ACC
Q56173
NITE
Grana_00110
PmId
[7476861] Identification of Streptomyces violaceoruber Tu22 genes involved in the biosynthesis of granaticin. (Mol Gen Genet. , 1995)
[9831526] The granaticin biosynthetic gene cluster of Streptomyces violaceoruber Tu22: sequence analysis and expression in a heterologous host. (Chem Biol. , 1998)
ACC
Q9ZGH3
NITE
Pikro_00130
PmId
[9770448] A gene cluster for macrolide antibiotic biosynthesis in Streptomyces venezuelae: architecture of metabolic diversity. (Proc Natl Acad Sci U S A. , 1998)
[14570895] High resolution X-ray structure of dTDP-glucose 4,6-dehydratase from Streptomyces venezuelae. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-hexose 4,6-dehydratase]
MHGSHYVRSLLDGAYGGDGTDTVTVLDKLTYAGNRDNLPASHERLTFVRGDICDLPLLLD
LLPGHDAVVHFAAESHVDRSLESAAEFVRTNVLGTQTVLEAALRTGVQRLVHVSTDEVYG
TIDEGSWTEDFPLLPNSPYAASKASSDLVARSYWRTHGLDLSITRCSNNYGPYQHPEKLI
PRFVTNLLEGHPVPVYGDGRNVREWLHVDDHCRAIHLVLPPAGRARRTTSASGNELTNLD
LTERILDLCGADRSMIRYVEDRKGHDLRYSLSDAKIREELGYTPRTSFEDGLRRTVDWYR
DNPQWWKAGKEK
selected fasta
>putative dTDP-glucose 4,6-dehydratase [NDP-hexose 4,6-dehydratase]
ATGCACGGCTCCCACTACGTCCGCTCCCTCCTCGACGGGGCGTACGGCGGCGACGGCACC
GACACCGTCACCGTCCTCGACAAGCTGACCTACGCGGGCAACCGGGACAACCTGCCCGCC
TCCCACGAGCGGCTCACCTTCGTCCGCGGCGACATCTGCGACCTGCCGCTGCTGCTCGAC
CTCCTCCCCGGGCACGACGCGGTCGTCCACTTCGCCGCCGAGTCGCACGTCGACCGGTCC
CTGGAGTCGGCCGCCGAGTTCGTCCGCACCAACGTCCTCGGCACCCAGACCGTCCTGGAG
GCCGCGCTGCGCACCGGCGTCCAGCGGCTCGTGCACGTCTCCACCGACGAGGTGTACGGC
ACGATCGACGAGGGCTCGTGGACCGAGGACTTCCCGCTCCTGCCCAACTCCCCGTACGCC
GCCTCCAAGGCGAGCTCGGACCTGGTGGCCCGCTCCTACTGGCGCACCCACGGGCTCGAC
CTGTCGATCACCCGCTGCTCCAACAACTACGGGCCGTACCAGCACCCCGAGAAGCTCATC
CCGCGCTTCGTCACCAACCTCCTGGAGGGCCACCCGGTGCCGGTCTACGGCGACGGGCGG
AACGTCCGCGAGTGGCTGCACGTCGACGACCACTGCCGGGCGATCCACCTGGTGCTACCA
CCGGCCGGGCGGGCGAGACGTACAACATCGGCAAGCGGGAACGAGCTCACCAACCTCGAC
CTGACCGAACGCATCCTGGACCTCTGCGGCGCCGACCGCTCGATGATCCGGTACGTCGAG
GACCGCAAGGGACACGACCTGCGGTACTCGCTCTCCGACGCCAAGATCCGCGAAGAGCTG
GGCTACACGCCCCGGACCTCCTTCGAGGACGGCCTGCGCCGGACCGTCGACTGGTACCGC
GACAACCCCCAGTGGTGGAAGGCCGGCAAGGAGAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [2-219]  2.19999999999997e-58 PF01370
PF01370   Epimerase
IPR005888 dTDP-glucose 4,6-dehydratase (Family)
 [3-307]  8.49999999999995e-116 TIGR01181
TIGR01181   DTDP_gluc_dehyt
IPR016040 NAD(P)-binding domain (Domain)
 [3-168]  1.70000000000001e-57 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit