close all open/close all

CDS information : Jado_00270


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction26,828 / 27,805 / + [in whole cluster]
8,735 / 9,712 / + [in contig]
Location26828..27805 [in whole cluster]
8735..9712 [in contig]
TypeCDS
Length978 bp (325 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative NDP-hexose C-4 ketoreductase
Product (GenBank)NDP-4-keto-6-deoxyhexose 4-ketoreductase
Gene
Gene (GenBank)jadV
EC number
Keyword
  • L-digitoxose
Note
Note (GenBank)
  • JadV
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
Related Reference
ACC
Q9F834
NITE
Megalo_00080
PmId
[20418422] TDP-L-megosamine biosynthesis pathway elucidation and megalomicin a production in Escherichia coli. (Appl Environ Microbiol. , 2010)

close this sectionSequence

selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose 4-ketoreductase]
MVVLGAAGFVGSAVLRELARHDLRVRAVSRRPVTVPAGARAEVETRSVDLTVPGAMAGAI
EGADVVVHSIAYIAGSSTWRITDGDTGAERVNVGLVRDLVEAVRASGRPDTAVLFTGSVS
AAGPSERGVYDGTEPDEPQGEYDRQKLAAERVLLAASAEGVLRGISLRLPTVFGYGPDST
ARDKGIVSSMVRRAVAGEPITMWHDGTVRRDLLYVEDVARAIAAALGHLDALAGRHWVLG
SGHGAELGPVFTTVARMVAERTGKPPVAVRSVEPPAHAEARDFASVTVDPRAFHEVTGWR
AEVPLDEALDRTTAFSASGAEEHFG
selected fasta
>putative NDP-hexose C-4 ketoreductase [NDP-4-keto-6-deoxyhexose 4-ketoreductase]
GTGGTCGTCCTCGGCGCCGCCGGCTTCGTCGGCTCCGCCGTCCTGCGCGAACTCGCCCGC
CACGACCTGCGGGTGCGGGCCGTCTCCCGGCGCCCGGTGACCGTCCCGGCCGGCGCCCGC
GCCGAGGTGGAGACCCGCAGCGTCGACCTCACCGTCCCCGGCGCGATGGCCGGGGCGATC
GAGGGCGCCGACGTGGTCGTCCACTCGATCGCCTACATCGCGGGCTCCTCGACCTGGCGC
ATCACGGACGGCGACACCGGCGCCGAGCGGGTCAACGTGGGACTCGTACGGGACCTGGTC
GAGGCCGTGCGGGCGAGCGGCCGCCCCGACACCGCCGTCCTGTTCACCGGCTCCGTCTCC
GCCGCCGGACCCTCGGAGCGGGGCGTCTACGACGGTACGGAGCCGGACGAGCCGCAGGGC
GAGTACGACCGGCAGAAGCTGGCGGCCGAGCGGGTGCTGCTCGCGGCGAGCGCCGAGGGC
GTGCTGCGCGGGATCTCGCTCCGGCTCCCCACGGTCTTCGGCTACGGCCCCGACTCGACC
GCGCGGGACAAGGGCATCGTCTCCTCGATGGTCCGCCGGGCGGTGGCGGGCGAGCCGATC
ACCATGTGGCACGACGGCACGGTCCGCCGCGACCTGCTGTACGTGGAGGACGTGGCGCGC
GCTATCGCGGCGGCCCTCGGCCACCTCGACGCGCTCGCGGGACGGCACTGGGTGCTCGGC
AGCGGGCACGGCGCCGAGCTCGGCCCGGTCTTCACCACGGTCGCCCGGATGGTGGCGGAG
CGGACCGGCAAGCCGCCGGTGGCCGTGCGCTCGGTGGAGCCGCCCGCGCACGCCGAGGCC
CGGGACTTCGCCAGCGTCACCGTCGACCCGCGCGCCTTCCACGAGGTCACCGGCTGGCGG
GCCGAGGTCCCGCTGGACGAGGCCCTGGACCGGACGACGGCCTTCAGCGCGAGCGGCGCG
GAGGAGCACTTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001509 NAD-dependent epimerase/dehydratase (Domain)
 [1-240]  1.5e-48 PF01370
PF01370   Epimerase
IPR016040 NAD(P)-binding domain (Domain)
 [2-221]  1.5e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-41]  0.296 Signal
Bacteria, Gram-positive   
TMHMM No significant hit