close all open/close all

CDS information : Jado_00280


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction28,477 / 27,863 / - [in whole cluster]
10,384 / 9,770 / - [in contig]
Locationcomplement(27863..28477) [in whole cluster]
complement(9770..10384) [in contig]
TypeCDS
Length615 bp (204 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
ProductTetR family transcriptional repressor
Product (GenBank)JadR*
Gene
Gene (GenBank)jadR*
EC number
Keyword
Note
Note (GenBank)
  • similar to TetR; repressor
Reference
ACC
PmId
[11932454] Biosynthesis of the dideoxysugar component of jadomycin B: genes in the jad cluster of Streptomyces venezuelae ISP5230 for L-digitoxose assembly and transfer to the angucycline aglycone. (Microbiology. , 2002)
[23832247] JadR and jadR2 act synergistically to repress jadomycin biosynthesis. (Sci China Life Sci. , 2013)
[24112541] JadR*-mediated feed-forward regulation of cofactor supply in jadomycin biosynthesis. (Mol Microbiol. , 2013)

close this sectionSequence

selected fasta
>TetR family transcriptional repressor [JadR*]
MATRKYEQRLRAEAAAETRRRILDALYEQLRSAPSEAVGLDRIARTAGVSRSTVYTTFGS
RSGLFDALGADLLHRGGFERMVREVLQPDAREGLRGGIRGNVEMYAAHRDVMRALYSMAA
LDAEAVGGAVQRMETGRAAGMDDLARRLGAQGELREDVTVAEAARRLWLFSAFDSFDLLY
TGRSMTVEQVTSTLTTAAEHALCR
selected fasta
>TetR family transcriptional repressor [JadR*]
ATGGCCACCAGGAAGTACGAACAGCGCCTCCGGGCGGAGGCGGCAGCCGAGACCCGCCGG
CGCATCCTCGACGCGCTGTACGAGCAGCTCCGATCGGCCCCCTCCGAGGCCGTCGGCCTC
GACCGGATCGCCCGCACGGCGGGCGTGTCGCGGTCCACCGTGTACACGACCTTCGGCTCG
CGCTCCGGGCTCTTCGACGCCCTCGGCGCGGACCTGCTGCACCGCGGCGGCTTCGAGCGG
ATGGTGCGCGAGGTGCTCCAGCCCGACGCGCGCGAAGGGCTCCGCGGCGGCATCCGGGGC
AACGTCGAGATGTACGCGGCCCACCGCGACGTCATGCGCGCCCTGTACTCCATGGCCGCG
CTCGACGCCGAGGCGGTCGGCGGCGCGGTCCAGCGGATGGAGACCGGACGCGCCGCCGGG
ATGGACGACCTCGCCCGGCGGCTCGGCGCGCAGGGTGAGCTGCGCGAGGACGTCACGGTC
GCCGAGGCGGCCCGCCGTCTCTGGCTGTTCTCGGCCTTCGACAGCTTCGACCTGCTCTAC
ACCGGCCGTTCGATGACGGTGGAGCAGGTCACCTCGACCCTCACCACCGCCGCCGAACAC
GCCCTCTGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [16-76]  17.92 PS50977
PS50977   HTH_TETR_2
 [22-68]  6.9e-09 PF00440
PF00440   TetR_N
IPR009057 Homeodomain-like (Domain)
 [12-75]  9.6e-12 SSF46689
SSF46689   Homeodomain-like
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [89-204]  3.1e-08 SSF48498
SSF48498   Tetracyclin repressor-like, C-terminal domain
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [9-204]  9.9e-25 G3DSA:1.10.357.10
G3DSA:1.10.357.10   no description
SignalP No significant hit
TMHMM No significant hit