close all open/close all

CDS information : Jado_00290


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction28,522 / 29,238 / + [in whole cluster]
10,429 / 11,145 / + [in contig]
Location28522..29238 [in whole cluster]
10429..11145 [in contig]
TypeCDS
Length717 bp (238 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productflavin reductase
Product (GenBank)JadY
Gene
Gene (GenBank)jadY
EC number
Keyword
Note
Note (GenBank)
  • contains an NAD(P)H dehydrogenase (quinone) domain; similar to Streptomyces coelicolor sequence deposited in GenBank Accession Number AL132184
Reference
ACC
PmId
[23177193] Identification of JadG as the B ring opening oxygenase catalyzing the oxidative C-C bond cleavage reaction in jadomycin biosynthesis. (Chem Biol. , 2012)
Related Reference
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>flavin reductase [JadY]
MLSDESAKTGCPRNRRQVHRAIHRAKPGSEAEGAPHDPDRRHHRQHRPGRRSTAVAQWVE
EAAGRHEAIKAGGATVELVDIAEFGLPLLDESVPAAFGQYANEHTKRWSEKIASFDAFVF
VTPEYNRSVPAALKNAIDYLYAEWQNKSAGFVSYGVQGGTRAIDHLRVTLAEVKVADVPT
AVSLPVFTDFTFENPMDPTETGRVTPGPHQEPTLFKMFDEIIAWAEALKPLRAAGAAV
selected fasta
>flavin reductase [JadY]
ATGCTGTCCGACGAAAGCGCGAAGACAGGCTGTCCGCGAAATCGCCGCCAGGTCCACCGC
GCCATCCACCGCGCAAAACCCGGATCCGAAGCAGAGGGAGCACCACATGACCCGGATCGC
CGTCATCATCGGCAGCACCGTCCCGGCCGCCGCTCGACCGCCGTCGCCCAGTGGGTCGAG
GAGGCCGCGGGCCGCCACGAGGCGATCAAGGCCGGCGGCGCCACCGTCGAGCTCGTCGAC
ATCGCCGAGTTCGGCCTGCCGCTGCTCGACGAGTCCGTCCCGGCCGCCTTCGGCCAGTAC
GCCAACGAGCACACCAAGCGCTGGTCCGAGAAGATCGCGTCCTTCGACGCCTTCGTCTTC
GTCACCCCGGAGTACAACCGCTCCGTCCCGGCCGCGCTCAAGAACGCCATCGACTACCTG
TACGCCGAGTGGCAGAACAAGTCCGCCGGCTTCGTCAGCTACGGCGTCCAGGGCGGCACC
CGCGCCATCGACCACCTGCGGGTCACCCTCGCCGAGGTCAAGGTCGCCGACGTGCCGACC
GCCGTCTCGCTGCCGGTCTTCACCGACTTCACCTTCGAGAACCCCATGGACCCGACCGAG
ACCGGTCGCGTCACCCCCGGCCCGCACCAGGAGCCCACGCTCTTCAAGATGTTCGACGAG
ATCATCGCCTGGGCCGAGGCCCTCAAGCCGCTCCGTGCCGCGGGGGCGGCCGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [46-183]  2.29999999999998e-35 PF03358
PF03358   FMN_red
SignalP No significant hit
TMHMM No significant hit