close all open/close all
Jado_00290 Jado_00290   last last

CDS information : Jado_00300


close this sectionLocation

Organism
StrainISP5230 (=NBRC 13096)
Entry nameJadomycin B
Contig
Start / Stop / Direction29,343 / 30,635 / + [in whole cluster]
11,250 / 12,542 / + [in contig]
Location29343..30635 [in whole cluster]
11250..12542 [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase(fragment)
Product (GenBank)JadZ
Gene
Gene (GenBank)jadZ
EC number
Keyword
Note
Note (GenBank)
  • similar to oxidoreductase-like protein, polyphenol oxidase and spore coat outer protein
Reference
ACC
Related Reference
ACC
P07788
PmId
[3135411] Identification of the promoter for a spore coat protein gene in Bacillus subtilis and studies on the regulation of its induction at a late stage of sporulation. (J Mol Biol. , 1988)
[11514528] CotA of Bacillus subtilis is a copper-dependent laccase. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative oxidoreductase(fragment) [JadZ]
MTTSRRELLKLMTAAGAALTASGLLISRTSLSDTRAGGPAGASPFAAQPVAAQALAPIVT
PFRTAMPIPPVARPVSVTSTTDTYSIPVTQTTAEIIPGVRTPVLTYGGSFPGPTIKARSG
RRVVVKQPNRITTGTSMHLHGAVVDPANDGGPMDLITPGGQRTYTYPNPQVAATLWYHDH
AHHMEAEHVYRGMSGFYLISDDNEDALPLPRGTYDVPIVVRDIGLNPDGTLFFDHNFTPG
RRSWSTGKPQPYFQVAARKYRLRILNGSNQRPFEFRLSDGGEFTQIASDRGLLPAPYTTT
TLPLSPAERADIVVDFSRYPVGSSVVLENAYFPEPSNKEILRFDVVRSAYDPSSVPARLA
TLPPTAAPTQTRNYTLDFDVQTGAGSISGKTWDEQRVDTTVRQGDTEVWEIKNTHPFIPH
NFHIHLVDFRI
selected fasta
>putative oxidoreductase(fragment) [JadZ]
ATGACCACGTCCCGACGGGAGCTGCTCAAGCTGATGACGGCCGCGGGGGCCGCCCTCACC
GCGAGCGGACTCCTCATCAGCCGGACCTCGCTCAGCGACACCCGGGCCGGCGGCCCGGCG
GGCGCCTCGCCGTTCGCCGCCCAGCCGGTGGCCGCCCAGGCCCTCGCCCCGATCGTCACG
CCCTTCCGCACCGCCATGCCCATCCCGCCGGTGGCCCGCCCGGTCTCCGTCACCTCGACC
ACCGACACGTACAGCATCCCGGTCACCCAGACCACGGCGGAGATCATCCCCGGGGTCCGC
ACCCCCGTCCTCACCTACGGCGGCAGCTTCCCCGGCCCCACCATCAAGGCGCGCTCCGGT
CGGCGCGTGGTCGTCAAGCAGCCCAACCGGATCACCACCGGCACCTCCATGCACCTGCAC
GGAGCGGTCGTCGACCCCGCCAACGACGGCGGCCCCATGGACCTGATCACGCCCGGCGGG
CAGCGCACGTACACCTACCCCAACCCGCAGGTGGCGGCCACCCTCTGGTACCACGACCAC
GCCCACCACATGGAGGCCGAGCACGTCTACCGCGGCATGTCGGGCTTCTACCTGATATCC
GACGACAACGAGGACGCGCTGCCCCTGCCGCGCGGCACCTACGACGTGCCGATCGTCGTT
CGCGACATCGGGCTCAACCCCGACGGCACCCTCTTCTTCGACCACAACTTCACACCCGGC
CGCAGATCCTGGTCAACGGGCAAGCCGCAGCCCTACTTCCAGGTCGCCGCCCGCAAGTAC
CGGCTGCGCATCCTCAACGGCTCCAACCAGCGGCCCTTCGAGTTCCGGCTCTCCGACGGC
GGCGAGTTCACCCAGATCGCCTCCGACCGCGGCCTGCTCCCCGCCCCGTACACGACGACG
ACCCTGCCGCTCTCGCCGGCCGAACGGGCCGACATCGTCGTCGACTTCTCGCGCTACCCC
GTGGGCAGCAGCGTCGTCCTGGAGAACGCCTACTTCCCGGAGCCCTCCAACAAGGAGATC
CTCCGCTTCGACGTCGTCCGCTCCGCCTACGACCCCAGCTCGGTCCCGGCCCGGCTCGCC
ACCCTGCCGCCGACCGCCGCGCCGACCCAGACGCGCAACTACACGCTCGACTTCGACGTG
CAGACCGGCGCGGGCTCGATCAGCGGCAAGACCTGGGACGAGCAGCGCGTCGACACCACG
GTGCGCCAGGGGGACACCGAGGTCTGGGAGATCAAGAACACCCACCCCTTCATCCCGCAC
AACTTCCACATCCACCTGGTGGACTTCCGGATC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001117 Multicopper oxidase, type 1 (Domain)
 [250-318]  2.4e-05 PF00394
PF00394   Cu-oxidase
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-36]  PS51318
PS51318   TAT
IPR008972 Cupredoxin (Domain)
 [58-207]  1.90000694315261e-33 SSF49503 [206-319]  3.1999989904635e-23 SSF49503 [346-431]  4.60000044330862e-11 SSF49503
SSF49503   Cupredoxin
 [61-198]  4.9e-40 G3DSA:2.60.40.420 [199-323]  1.70000000000001e-33 G3DSA:2.60.40.420 [361-431]  3.5e-28 G3DSA:2.60.40.420
G3DSA:2.60.40.420   Cupredoxin
IPR011707 Multicopper oxidase, type 3 (Domain)
 [89-203]  2.8e-27 PF07732
PF07732   Cu-oxidase_3
SignalP
 [1-52]  1 Signal
Bacteria, Gram-positive   
 [1-31]  0.896 Signal
Eukaryota   
 [1-32]  1 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
Jado_00290 Jado_00290   last last