close all open/close all
first first   Kirro_00020 Kirro_00020

CDS information : Kirro_00010


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction1,172 / 3 / - [in whole cluster]
1,172 / 3 / - [in contig]
Locationcomplement(3..1172) [in whole cluster]
complement(3..1172) [in contig]
TypeCDS
Length1,170 bp (389 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MTHHRRRAARRRDRTRRITPRTHWLLLSVFAVTLSTALLLQGYTHHMFGITSDAVTGVRG
RSDMVPARVAHGGPVIAGAATSPHTARVRPRTIALTFDDGPDPTWTPRILEVLRRNHVHA
TFFVVGTQVVAHPELVRRIVADGHQIGIHTFTHPDLARLAPWQRSLELRETQLAVAGAAG
VTTALLRPPYSSENGALDDADWSVLKQADAAGYVTVLSTQDAEDWQRPGARRILANATPH
GHGGQVLLMHDAGGDRSQTVAALAALVPRLKAQGFRFATVSDAVGMAAPVQPAGLGDHLQ
GLALVRALQGGDRVVRLLGWLMYAAGAISVLRAAVVLTAARRHRRLRAGGPDRSWGPRVT
EPVSVIVPAYNESAGIEAAVRSLLASDHPV
selected fasta
>[hypothetical protein]
GTGACCCATCACCGCCGCCGCGCCGCCCGGCGCCGCGACCGCACTCGCCGGATCACACCC
CGCACCCATTGGCTGCTGCTCAGCGTGTTCGCGGTCACCTTGTCCACGGCCCTGCTGCTC
CAGGGCTACACCCACCACATGTTCGGCATCACCTCGGACGCCGTGACCGGCGTCCGGGGC
AGGAGCGACATGGTGCCCGCCCGGGTGGCCCACGGCGGCCCCGTGATCGCGGGCGCCGCC
ACCTCTCCCCACACCGCCCGGGTGCGGCCCCGCACCATCGCGCTGACCTTCGACGACGGC
CCGGACCCCACCTGGACGCCACGCATCCTGGAGGTGCTGCGCCGCAACCACGTGCACGCG
ACCTTCTTCGTCGTCGGGACCCAGGTCGTCGCCCACCCCGAGCTGGTCCGCCGTATCGTC
GCCGACGGCCACCAGATCGGCATCCACACCTTCACCCATCCCGACCTGGCCCGTCTCGCC
CCGTGGCAACGCTCGCTGGAGTTGCGTGAGACGCAGTTGGCGGTGGCCGGCGCCGCGGGG
GTCACCACCGCACTGCTCAGGCCGCCGTACTCCTCGGAGAACGGCGCGCTGGACGACGCC
GACTGGTCCGTCCTGAAGCAGGCCGACGCGGCGGGTTACGTCACGGTGCTGTCCACCCAG
GACGCCGAGGACTGGCAGCGCCCCGGTGCGCGCCGCATCCTCGCGAACGCGACACCACAC
GGGCACGGCGGGCAGGTCCTGCTCATGCACGACGCCGGCGGCGACCGCTCCCAGACCGTC
GCCGCGCTGGCTGCCCTGGTCCCACGCCTCAAGGCGCAGGGCTTCAGGTTCGCGACGGTC
TCCGACGCGGTCGGCATGGCCGCACCCGTACAGCCCGCCGGCCTGGGCGATCACCTGCAA
GGACTGGCCCTCGTCAGGGCCCTCCAGGGCGGTGACCGGGTCGTCCGGCTGCTGGGCTGG
CTGATGTACGCGGCAGGCGCGATCAGCGTGCTGCGCGCGGCCGTCGTACTGACAGCCGCC
CGGCGGCACCGCCGCCTGCGGGCGGGCGGACCCGACCGGTCCTGGGGACCACGGGTCACC
GAGCCGGTCAGCGTCATCGTTCCCGCCTACAACGAGAGCGCCGGGATCGAGGCGGCCGTG
CGTTCGCTGCTCGCATCCGACCATCCGGTC

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002509 Polysaccharide deacetylase (Domain)
 [87-286]  6.19999999999994e-56 G3DSA:3.20.20.370
G3DSA:3.20.20.370   Polysac_deacetylase
 [89-197]  2.6e-29 PF01522
PF01522   Polysacc_deac_1
IPR011330 Glycoside hydrolase/deacetylase, beta/alpha-barrel (Domain)
 [78-294]  4.90001027782408e-57 SSF88713
SSF88713   Glyco_hydro/deAcase_b/a-brl
SignalP
 [1-40]  0.996 Signal
Bacteria, Gram-negative   
 [1-42]  0.999 Signal
Bacteria, Gram-positive   
 [1-37]  0.462 Signal
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [314-336]  Transmembrane (o-i)
Transmembrane 2   
first first   Kirro_00020 Kirro_00020