close all open/close all

CDS information : Kirro_00020


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction2,030 / 1,188 / - [in whole cluster]
2,030 / 1,188 / - [in contig]
Locationcomplement(1188..2030) [in whole cluster]
complement(1188..2030) [in contig]
TypeCDS
Length843 bp (280 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MQWTDQSSGGYGADPYDSAGDGYDYACEHDGGTTTGMAATPRASGQLAQGTYPAVDAYAR
GTDLYGAEAHVHDAGPGAAATVSGVHGDVLTVDVLTAPAPGLGTPGDPTPGAETPFGSDS
VRPVFVDSSGRRQRRVRRAARLLVIPAGGYVALLISAVLGGPRLSAPFVPQPDSPDRSTP
RASVPDTSAGTGDSAESTRSAAARKNSRSTAAQKNASPTERPTAPATTAATPVPTTAPTS
AASPTSSTSVSAPAPAATPAVPTRPTPRGRALGTSHKPVR
selected fasta
>[hypothetical protein]
GTGCAGTGGACGGACCAGAGCAGCGGAGGGTACGGCGCGGATCCGTACGACAGTGCCGGG
GACGGGTACGACTACGCCTGCGAGCACGACGGCGGTACCACCACCGGCATGGCCGCCACG
CCCCGGGCGTCGGGGCAACTCGCGCAGGGGACGTACCCCGCGGTCGACGCCTACGCACGG
GGGACGGATCTCTACGGCGCCGAGGCGCACGTGCACGATGCCGGACCCGGGGCCGCCGCG
ACCGTGTCGGGCGTCCACGGTGACGTCCTCACCGTGGACGTCCTCACCGCGCCGGCCCCG
GGACTCGGCACGCCCGGCGATCCCACGCCGGGAGCGGAGACTCCGTTCGGAAGCGATTCG
GTGCGGCCGGTCTTCGTGGACTCCTCGGGCCGCCGCCAGCGCCGCGTGCGGCGCGCGGCC
CGGCTGCTGGTGATCCCCGCGGGCGGCTACGTCGCCCTGCTGATCAGCGCCGTGCTCGGC
GGCCCCAGACTCAGCGCCCCGTTCGTGCCCCAGCCGGACTCCCCGGACCGCTCCACGCCA
CGCGCGTCCGTGCCCGACACCTCCGCCGGTACCGGCGACTCCGCGGAGAGCACGCGGTCC
GCTGCGGCGCGGAAGAACTCCCGCTCCACGGCGGCGCAGAAGAACGCCAGTCCGACCGAA
CGGCCGACAGCCCCCGCCACCACCGCGGCCACACCCGTGCCGACCACGGCGCCCACCAGC
GCCGCGTCTCCGACCTCTTCCACCTCCGTCTCGGCCCCGGCCCCGGCCGCCACTCCTGCC
GTGCCCACCCGTCCGACCCCCAGGGGCCGCGCGCTCGGCACGTCCCACAAGCCCGTGAGA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM
 [139-161]  Transmembrane (i-o)
Transmembrane 1