close all open/close all

CDS information : Kirro_00030


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction2,887 / 2,246 / - [in whole cluster]
2,887 / 2,246 / - [in contig]
Locationcomplement(2246..2887) [in whole cluster]
complement(2246..2887) [in contig]
TypeCDS
Length642 bp (213 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative uridine kinase
Gene
Gene (GenBank)
EC number2.7.1.48
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative uridine kinase]
MTGVLAVAGGTASGKSTLAEALSLRWPETVALVHLDDYYVPAHDPLRGVWTVSADGHAVL
DWNHPGSIDETAAAHAIDAALRRPGVLLVVVEGLFALSLPSVVRRAAWRVYVETPDDIRL
ARKILRKIEAQRQDPRLSLRNYLQTGRDRHAAHVAPSRAAADLVVDGTASEAEMLAAVMP
LIGPALTPLPAAPSQARQVCGVPDTPGAPALAM
selected fasta
>[putative uridine kinase]
ATGACGGGTGTACTGGCGGTTGCAGGCGGCACCGCATCCGGCAAGTCCACCCTTGCCGAG
GCCCTGTCGCTGCGGTGGCCCGAGACCGTGGCGCTGGTCCACCTGGACGACTACTACGTG
CCCGCCCACGACCCCCTGAGGGGTGTGTGGACGGTCAGCGCCGACGGGCACGCCGTCCTC
GACTGGAACCATCCGGGATCGATCGACGAGACAGCGGCGGCACACGCCATCGACGCGGCG
CTGCGGCGCCCCGGCGTGCTGCTGGTGGTGGTCGAGGGCCTGTTCGCGCTGTCACTGCCG
TCCGTGGTGAGGCGGGCGGCGTGGCGGGTGTACGTCGAGACCCCCGACGACATACGACTG
GCCCGCAAGATCCTCCGGAAGATCGAGGCGCAGCGCCAGGACCCCCGGCTGTCCCTGCGC
AACTATCTGCAGACCGGCAGGGACCGCCACGCAGCCCATGTCGCGCCCTCCCGGGCAGCG
GCCGATCTGGTCGTGGACGGGACCGCGAGCGAGGCGGAGATGCTGGCCGCGGTCATGCCG
CTGATCGGGCCGGCCCTCACCCCACTGCCCGCGGCACCCTCGCAGGCGCGACAGGTATGC
GGTGTGCCCGACACCCCCGGAGCCCCGGCGCTCGCGATGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-19]  0.529 Signal
Bacteria, Gram-negative   
 [1-19]  0.766 Signal
Eukaryota   
TMHMM No significant hit