close all open/close all

CDS information : Kirro_00040


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction3,495 / 5,123 / + [in whole cluster]
3,495 / 5,123 / + [in contig]
Location3495..5123 [in whole cluster]
3495..5123 [in contig]
TypeCDS
Length1,629 bp (542 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MAGTRRWSRVTALLAAVSGLGLAALPGTANAAGTKLSIEAQDTYYAYQYGEGPPGDGGLF
LLELNLSAPEGTKPLAKNVKLTIDATELEGKAVITGAGGACSHQAYVYTCAYTSIDGKTS
VQPFYIKGAKGTKPGASGDIHYTATSSDAGTATATTHAVVGGPKLLTQREKAIADVTPGA
GFDLTPAVANVGPLAAPRGIGVKLFGEEGLKVAEQYSNCHYRPMPQPTAYCTFDTPIEPG
TAYAFDKPWHFTTSNDLMYATINYSTWPLGSGNPWEYDDPADYTVTGSGPELGLKPVSAS
GFPDFGGFVEVSTTQHADYRAIGGEVTGKLGQTVPVTLGVKNEGPGSMNLYSRPGQGSGT
YRVTPPEGTVITKIPFPGEDDDHACGAPIKGTRTYECEIPDIFPAGDTSELTFYVKIQEA
VAHPKAGSIEATGRTDFPNRDNHPENDSAPVTLTITGGTPSASPSASPSPSPSPSASASP
SAGASNGGSASNGGATSGGTSPEGGVMASTGAGALPWIAASAAAALAAGVAGVTLSRRRT
RG
selected fasta
>[hypothetical protein]
ATGGCGGGGACGAGGCGATGGAGCCGCGTGACGGCACTGCTGGCGGCGGTGAGCGGGCTC
GGCCTGGCAGCGCTGCCCGGCACGGCGAACGCCGCCGGCACGAAGCTGTCGATCGAGGCG
CAGGACACCTACTACGCCTACCAGTACGGTGAGGGGCCGCCCGGCGACGGCGGCCTGTTC
CTCCTCGAACTCAACCTCAGCGCCCCGGAGGGCACCAAGCCCCTGGCCAAGAACGTCAAA
CTGACCATCGACGCCACGGAACTCGAGGGCAAGGCGGTCATCACCGGTGCCGGGGGTGCC
TGCTCGCACCAGGCCTACGTCTACACCTGCGCCTACACCTCGATCGACGGCAAAACCAGC
GTCCAGCCGTTCTACATCAAAGGGGCGAAGGGCACGAAGCCCGGCGCCTCCGGCGACATC
CACTACACCGCGACGTCCAGCGACGCCGGGACGGCCACCGCCACGACGCACGCGGTCGTC
GGCGGCCCCAAGCTGCTCACCCAGCGGGAAAAGGCGATTGCCGATGTCACACCCGGCGCC
GGCTTCGACCTCACGCCCGCCGTCGCCAACGTCGGCCCACTGGCCGCGCCCCGAGGCATC
GGCGTGAAGCTGTTCGGCGAGGAGGGGCTGAAGGTCGCCGAGCAGTACAGCAACTGCCAC
TACCGGCCGATGCCGCAGCCCACCGCGTACTGCACCTTCGACACCCCGATCGAGCCCGGC
ACGGCCTACGCCTTCGACAAGCCGTGGCACTTCACCACGTCGAACGACCTGATGTACGCC
ACCATCAACTACTCCACCTGGCCCCTGGGCAGCGGCAATCCGTGGGAGTACGACGATCCG
GCGGACTACACCGTCACCGGCAGCGGACCGGAGCTCGGCCTCAAGCCCGTGTCCGCTTCC
GGGTTCCCCGACTTCGGCGGCTTCGTCGAGGTGTCCACCACCCAGCACGCGGACTACCGC
GCGATCGGCGGCGAGGTCACCGGCAAGCTGGGCCAGACGGTACCGGTGACCCTCGGTGTG
AAGAACGAGGGCCCGGGTTCGATGAACCTCTACAGCCGCCCCGGCCAGGGTTCCGGCACC
TATCGCGTCACCCCGCCCGAGGGCACCGTGATCACGAAGATCCCCTTCCCCGGCGAGGAC
GACGACCACGCCTGCGGCGCACCCATCAAGGGCACCCGCACCTACGAGTGCGAGATCCCG
GACATCTTCCCGGCCGGCGACACCAGCGAGCTCACCTTCTACGTGAAGATCCAGGAGGCC
GTCGCCCATCCGAAGGCCGGTTCCATCGAGGCCACGGGCCGCACCGACTTCCCCAACCGC
GACAACCACCCGGAGAACGACTCCGCACCCGTGACCCTGACGATCACCGGCGGCACCCCG
TCGGCCTCGCCCTCCGCTTCCCCTTCTCCCTCTCCCTCTCCTTCCGCATCGGCGTCCCCG
AGCGCCGGCGCCTCCAACGGGGGCTCGGCCTCCAACGGCGGCGCCACGTCCGGCGGGACG
AGCCCCGAGGGCGGTGTGATGGCCTCCACCGGCGCGGGCGCACTGCCCTGGATCGCGGCG
TCGGCGGCAGCAGCGCTGGCGGCCGGCGTCGCGGGCGTCACGCTGTCGCGCCGACGGACG
CGCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-31]  1 Signal
Bacteria, Gram-positive   
 [1-31]  1 Signal
Bacteria, Gram-negative   
 [1-31]  0.999 Signal
Eukaryota   
TMHMM
 [7-29]  Transmembrane (i-o) [514-536]  Transmembrane (o-i)
Transmembrane 2