close all open/close all

CDS information : Kirro_00050


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction5,488 / 6,513 / + [in whole cluster]
5,488 / 6,513 / + [in contig]
Location5488..6513 [in whole cluster]
5488..6513 [in contig]
TypeCDS
Length1,026 bp (341 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative AraC family transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative AraC family transcriptional regulator]
MRPLVRTAALNGYVELSRSLGLDPRALMKSVGLDTADLAVQDRWISGTAVVRLLELSAAA
SAREDFGLLLAELRRFSNLGPISLLVREEPDVRSALALLIRHQHTYNEVLHARLSEGNGV
ATLKVDVRLGEPQPARQGTELAVAAFHRVLCGFLGPHWRPSAVRFAHPAPRDTASHRRAF
GPVVEFDRGFNGIEFYADDLDAANAMADAQLRSYTRQYFEPVAALREATEADRVRDLIEA
LLPTGRCSIEQVARSLGVDRRTVHRHLARSGQTFSSLLQSTRSALAEQFVPNPSRSLTEV
STLLGFSSLSAFSRWFHEHYGVGPREWRRSGGGGAATPGES
selected fasta
>[putative AraC family transcriptional regulator]
ATGAGACCCCTTGTCCGTACCGCCGCGCTGAACGGTTACGTCGAACTGAGCCGTTCCCTG
GGTCTCGACCCGCGCGCGCTGATGAAGAGCGTCGGGCTCGACACCGCCGACCTCGCCGTC
CAGGACCGGTGGATCTCGGGTACGGCCGTGGTCCGGCTGCTGGAGCTGTCCGCGGCCGCC
TCCGCGCGCGAGGACTTCGGGCTGCTCCTGGCGGAGCTGCGGCGCTTCTCCAATCTCGGC
CCGATCAGCCTCCTGGTGCGCGAGGAGCCCGACGTGCGCAGCGCCCTGGCCCTGCTCATC
CGCCACCAGCACACCTACAACGAGGTCCTGCACGCCCGGCTCTCCGAGGGCAACGGCGTC
GCGACGCTCAAGGTCGACGTGCGGCTCGGCGAGCCGCAGCCGGCCCGGCAGGGCACGGAG
CTCGCGGTGGCCGCGTTCCACCGGGTGCTGTGCGGCTTCCTCGGGCCGCACTGGCGGCCG
TCGGCGGTCCGCTTCGCACACCCGGCGCCGCGCGACACCGCGAGCCACCGCCGCGCGTTC
GGGCCCGTGGTCGAGTTCGACCGCGGCTTCAACGGCATCGAGTTCTACGCCGACGACCTG
GACGCGGCCAACGCGATGGCCGACGCGCAGCTGCGCAGCTACACCCGGCAGTACTTCGAG
CCCGTCGCGGCGCTGCGGGAAGCGACCGAGGCGGACCGGGTGCGCGACCTCATCGAGGCG
CTGCTGCCGACCGGGCGCTGCTCCATCGAGCAGGTCGCACGCAGCCTCGGCGTCGACCGG
CGCACCGTCCACCGGCATCTCGCACGCTCCGGGCAGACGTTCTCCTCGCTGCTGCAGTCC
ACCCGCTCGGCGCTCGCGGAGCAGTTCGTGCCCAACCCGAGCAGGTCGCTGACCGAGGTG
TCCACGCTGCTTGGGTTCTCGTCGCTGAGCGCGTTCTCCCGCTGGTTCCACGAGCACTAC
GGCGTAGGACCGCGGGAGTGGCGCCGGAGCGGGGGCGGCGGAGCGGCGACGCCCGGCGAG
AGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009057 Homeodomain-like (Domain)
 [238-271]  1.8e-05 G3DSA:1.10.10.60 [282-331]  2.2e-11 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
 [281-330]  5.40000570248859e-11 SSF46689
SSF46689   Homeodomain_like
IPR018060 DNA binding HTH domain, AraC-type (Domain)
 [232-330]  PS01124
PS01124   HTH_ARAC_FAMILY_2
 [246-328]  1.79999754022375e-20 SM00342
SM00342   HTH_ARAC
IPR020449 Transcription regulator HTH, AraC- type (Family)
 [297-312]  8.39999858592306e-05 PR00032 [312-328]  8.39999858592306e-05 PR00032
PR00032   HTHARAC
SignalP No significant hit
TMHMM No significant hit