close all open/close all

CDS information : Kirro_00060


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction6,793 / 7,845 / + [in whole cluster]
6,793 / 7,845 / + [in contig]
Location6793..7845 [in whole cluster]
6793..7845 [in contig]
TypeCDS
Length1,053 bp (350 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MHFHDDSLFPENQEKLVIQAAPYGPEWLPGDAEDLPLTMDEHVQAAVDCHNAGATVLHIH
VRELDGKGSKRMSMFNELLGRLREAVPDMVLQIGGSISFAPEGEGGDAKWLAYDTRHLLA
ELTPAPDQVTIAINTSQMNIVEIMNDDDLAGTSMAKPDYYRAYRDMVVEAGPDFYLEHLK
RLRASGIQPHFQLAHLAQLETVERLIRAGVHTGPLVLNYVAIGGGFAGRHPADLVEFIRR
VPDGAVLTVESSMRAVAPMNAVAIALGQHVRVGNEDNLWRAKGEPMSSVAQVEQMVQISE
ALGRDIATGTDAKRIYRIGEYYADTDETLARLGMVPNRRPGQRGFMLRDA
selected fasta
>[hypothetical protein]
GTGCACTTCCACGACGACTCTCTCTTCCCGGAGAACCAGGAGAAGTTGGTCATCCAGGCC
GCGCCGTACGGGCCGGAGTGGCTGCCCGGCGACGCGGAGGACCTGCCGCTGACCATGGAC
GAGCACGTCCAGGCGGCCGTCGACTGCCACAACGCCGGCGCGACCGTGCTGCACATCCAC
GTCCGTGAGCTCGACGGCAAGGGCTCCAAGCGGATGTCCATGTTCAACGAGCTGCTCGGC
CGGCTGCGCGAGGCCGTGCCGGACATGGTGCTGCAGATCGGCGGTTCGATCTCCTTCGCC
CCCGAGGGCGAGGGCGGCGACGCCAAGTGGCTCGCGTACGACACCCGTCACCTGCTCGCC
GAACTCACTCCGGCGCCCGACCAGGTGACCATCGCGATCAACACCAGCCAGATGAACATC
GTCGAAATCATGAACGACGACGACCTGGCGGGCACCTCGATGGCGAAGCCCGACTACTAC
CGCGCCTACCGCGACATGGTCGTCGAGGCCGGTCCGGACTTCTACCTGGAGCACCTCAAG
AGGCTGCGCGCGAGCGGCATCCAGCCGCACTTCCAGCTCGCGCACCTGGCGCAGCTGGAG
ACCGTCGAGCGGCTGATCCGCGCGGGCGTCCACACCGGCCCGCTGGTCCTCAACTACGTC
GCCATAGGTGGCGGTTTCGCCGGTCGGCACCCGGCGGACCTGGTCGAGTTCATCCGTCGT
GTACCGGACGGCGCCGTCCTCACGGTCGAGAGTTCCATGCGCGCCGTGGCCCCGATGAAC
GCGGTGGCCATCGCCCTCGGCCAGCACGTGCGCGTCGGCAACGAGGACAACCTGTGGCGT
GCCAAGGGCGAGCCGATGTCCTCCGTGGCGCAGGTCGAGCAGATGGTGCAGATCTCCGAG
GCGCTCGGCCGGGACATCGCCACCGGCACGGACGCGAAGCGGATCTACCGGATCGGCGAG
TACTACGCCGACACCGACGAGACGCTGGCCCGCCTCGGCATGGTGCCCAACCGCCGTCCG
GGACAGCGCGGCTTCATGCTGCGCGACGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR008567 Protein of unknown function DUF849, prokaryotic (Family)
 [15-317]  3.99999999999998e-73 PF05853
PF05853   DUF849
IPR013785 Aldolase-type TIM barrel (Domain)
 [14-319]  5.69999999999998e-75 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP No significant hit
TMHMM No significant hit