close all open/close all

CDS information : Kirro_00070


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction7,934 / 8,908 / + [in whole cluster]
7,934 / 8,908 / + [in contig]
Location7934..8908 [in whole cluster]
7934..8908 [in contig]
TypeCDS
Length975 bp (324 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative zinc-containing alcolhol dehydrogenase
Gene
Gene (GenBank)
EC number1.6.5.5
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative zinc-containing alcolhol dehydrogenase]
MAHAVRFHETGGPDVLSWEEVTVGEPGPGEVRVRHEAVGLNFADTYFRTGLYPVRLPEGM
GVEAAGVVEAVGEGVTGVAAGDRVTYTGSPLGAYSTERIMPASHLIVLPRQISCETAAAM
TMRGLTAAYLLRRIHTLKSGDTVLLHAAAGGVGLILSQWAALLGIRVIGTVSSEEKAELA
LAHGCEHVIRYRHEDVAERVRELTGGAGVPVVFDSIGKDTFAGSLASLARRGLLVCFGTA
SGPVPPIDAMRLALAGSVFVTRPALADYIADPAERAALAGELFEHVVAGRIRIEINQRYD
LKDAEQAHRDLESGRTTGSSVFVL
selected fasta
>[putative zinc-containing alcolhol dehydrogenase]
GTGGCACATGCCGTCCGCTTCCACGAAACCGGTGGCCCCGACGTCCTCAGCTGGGAGGAG
GTGACCGTCGGCGAGCCCGGCCCCGGTGAGGTGCGCGTGCGGCACGAGGCCGTCGGGCTC
AACTTCGCCGACACCTACTTCCGCACCGGCCTGTACCCGGTCCGGCTGCCCGAGGGCATG
GGCGTCGAGGCCGCCGGCGTGGTGGAGGCGGTCGGCGAGGGCGTCACCGGCGTCGCCGCG
GGCGATCGCGTCACGTACACCGGAAGTCCGCTCGGTGCCTACAGCACGGAGCGGATCATG
CCCGCCTCGCACCTGATCGTGCTGCCCCGGCAGATCAGTTGCGAGACGGCGGCCGCGATG
ACCATGCGCGGCCTGACGGCGGCCTATCTGCTGCGCAGGATCCACACGCTGAAGTCAGGC
GACACCGTGCTGCTGCACGCGGCGGCGGGCGGGGTGGGCCTGATCCTGAGCCAGTGGGCC
GCACTGCTCGGCATCCGTGTGATCGGGACGGTGTCCAGCGAGGAGAAGGCCGAACTCGCC
CTGGCACACGGATGCGAGCACGTCATCCGCTACCGGCACGAGGACGTGGCCGAGCGGGTG
CGGGAGCTGACAGGCGGGGCGGGGGTCCCGGTGGTGTTCGACAGCATCGGCAAGGACACC
TTCGCGGGCTCGCTGGCCTCCCTGGCCCGCCGCGGACTGCTGGTCTGCTTCGGCACCGCG
TCGGGCCCGGTGCCGCCGATCGACGCGATGCGACTCGCCCTGGCGGGGTCGGTGTTCGTC
ACCAGGCCCGCGCTGGCCGACTACATCGCCGACCCGGCCGAGCGTGCCGCGCTCGCGGGC
GAGCTGTTCGAGCACGTCGTCGCCGGCCGCATCAGGATCGAGATCAATCAGCGCTATGAC
CTCAAGGACGCGGAGCAGGCCCATCGCGACCTGGAGTCCGGGCGGACCACGGGGTCGTCC
GTCTTCGTCCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011032 GroES-like (Domain)
 [2-147]  2.99998750445706e-40 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [151-256]  3.3e-30 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [28-86]  9.20000000000002e-12 PF08240
PF08240   ADH_N
IPR016040 NAD(P)-binding domain (Domain)
 [144-251]  3.8e-31 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit