close all open/close all

CDS information : Kirro_00080


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction8,964 / 9,887 / + [in whole cluster]
8,964 / 9,887 / + [in contig]
Location8964..9887 [in whole cluster]
8964..9887 [in contig]
TypeCDS
Length924 bp (307 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative taurine dioxygenase
Gene
Gene (GenBank)
EC number1.14.11.17
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative taurine dioxygenase]
MTDILSPSGHAPGRARARQGARCTSIEVERLTCAIGAELRGVNIADAVRDDDLFAEIKSL
LLEHRVLFLRDQDLSRAEHVAFASRFGALEDHPVAGSDPDHPGLVRIYKELDSAPEHYEN
ALHTDGTWRVNPSMGAVLHCVESPPVGGDTIWVDMVAAYDRLPAHVKAQIAGLRARHSIE
ASFGAVMPEEKRIALHEQYPDAEHPVVRTHPETGEKILFVNAFTTHFTNFHTPANVRFGQ
DYAPGASHLLSYLISQAAVPEYQVRWRWTPGSVAIWDNRSTQHYAVQDYWPGVRKMERAG
IVGDKPF
selected fasta
>[putative taurine dioxygenase]
ATGACAGACATCCTTTCGCCGTCCGGCCACGCCCCGGGGCGGGCGCGGGCGCGCCAGGGC
GCCCGATGCACCTCGATCGAGGTCGAGCGGCTGACCTGCGCCATCGGCGCCGAACTGCGC
GGTGTGAACATCGCCGACGCCGTCCGTGACGACGACCTGTTCGCCGAGATCAAGAGCCTG
CTGCTGGAGCACCGCGTGCTGTTCCTGCGGGACCAGGACCTCTCGCGCGCCGAGCATGTC
GCCTTCGCGTCGCGCTTCGGCGCGCTGGAGGACCACCCCGTCGCCGGCAGCGACCCCGAC
CACCCCGGCCTGGTCCGCATCTACAAGGAGCTGGACAGCGCGCCGGAGCACTACGAGAAC
GCCCTCCACACGGACGGTACCTGGCGGGTGAACCCGTCGATGGGCGCCGTGCTGCACTGC
GTCGAGTCGCCCCCGGTAGGCGGCGACACCATCTGGGTCGACATGGTGGCGGCGTACGAC
AGGCTGCCCGCCCACGTGAAGGCGCAGATCGCGGGGTTGCGGGCCCGGCACAGCATCGAG
GCCAGCTTCGGCGCGGTCATGCCCGAGGAGAAGCGGATCGCGCTCCACGAGCAGTACCCG
GACGCCGAGCACCCGGTGGTGCGGACGCACCCCGAGACCGGGGAGAAGATCCTCTTCGTC
AACGCCTTCACCACGCACTTCACCAACTTCCACACCCCGGCGAACGTCCGGTTCGGCCAG
GACTACGCGCCCGGCGCGAGCCACTTGCTCAGCTACCTGATCAGCCAGGCCGCCGTCCCC
GAGTACCAGGTGCGCTGGCGCTGGACCCCCGGTTCCGTAGCCATCTGGGACAACCGGTCG
ACCCAGCACTACGCCGTACAGGACTACTGGCCCGGCGTCCGCAAGATGGAGCGCGCCGGG
ATCGTGGGCGACAAACCCTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003819 Taurine catabolism dioxygenase TauD/TfdA (Family)
 [28-299]  3.29999999999997e-53 PF02668
PF02668   TauD
SignalP
 [1-30]  0.029 Signal
Bacteria, Gram-negative   
TMHMM No significant hit