close all open/close all

CDS information : Kirro_00090


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction9,930 / 11,348 / + [in whole cluster]
9,930 / 11,348 / + [in contig]
Location9930..11348 [in whole cluster]
9930..11348 [in contig]
TypeCDS
Length1,419 bp (472 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative major facilitator superfamily transporter
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative major facilitator superfamily transporter]
MEFHTPAQTSAPTVEATLPAPGAFPSVWPVPRGYAWTVFALSFGLLLSDYMSRQVLNAVF
PMLKSEWLLSDAALGSLSSIVALAVGVLTFPMSLMADRWGRVRCLLFAATLWSIATVGCA
MSADYGQMFVARLFVGIGEAAYGSVGIAVVLSIFPVALRATLSGTFIAGGAFGAVLGVSI
GGAVAQAAGWRWAFAVMGIFGLVLAAVYGVVVKERRLVRVADSAEDPSDAAGASAAGSRD
APPAPANVPLRAHLPRLFSSVSVISAYVGSGLQLFVAATLLSWLPSYFNRYYHLTTAQSG
SAAGGYALIIGVGMILGGVVSDRISAGVSIRKWAVAVGCSLGSLVLLTVAFQLPDGPVQL
GALAFGALLSAGSAGPAAAMVANLTPASVAATAFGTLTLANSLLGLAPGPALTGVLADHV
GLLGALRVVPLVAIAATAAFLVGRHWYERDLLRVGGLAAPAAESEPPAERPS
selected fasta
>[putative major facilitator superfamily transporter]
ATGGAGTTTCACACCCCTGCGCAGACCTCGGCTCCCACCGTGGAGGCGACCCTCCCGGCC
CCAGGGGCCTTCCCCTCGGTGTGGCCCGTTCCCCGGGGCTACGCCTGGACGGTCTTCGCG
CTCAGCTTCGGCCTGCTGCTGTCGGACTACATGTCCCGGCAGGTTCTCAACGCCGTCTTC
CCGATGCTCAAGTCCGAGTGGCTGTTGTCGGACGCCGCCCTCGGGTCGCTCAGCAGCATC
GTGGCGCTGGCGGTCGGCGTGCTGACCTTCCCGATGTCCCTCATGGCCGACCGGTGGGGG
CGGGTGCGCTGTCTGCTGTTCGCCGCCACGCTCTGGTCCATCGCCACCGTCGGATGCGCG
ATGTCGGCGGACTACGGCCAGATGTTCGTGGCCCGTCTCTTCGTCGGCATCGGCGAGGCG
GCCTACGGCAGCGTCGGGATCGCCGTGGTGCTGAGCATCTTCCCCGTCGCCCTGCGGGCC
ACCCTCTCCGGCACCTTCATCGCGGGCGGTGCGTTCGGGGCCGTGCTCGGCGTCTCCATC
GGTGGCGCTGTGGCCCAGGCGGCCGGCTGGCGTTGGGCGTTCGCCGTCATGGGCATCTTC
GGCCTGGTGCTCGCCGCGGTCTACGGCGTCGTCGTCAAGGAGCGCAGGCTCGTGCGGGTC
GCGGACTCCGCCGAGGATCCGTCGGATGCCGCCGGGGCGAGCGCCGCCGGATCGCGGGAC
GCGCCCCCGGCACCGGCGAACGTGCCGCTGCGCGCGCACCTGCCGCGGCTGTTCTCCTCC
GTCTCCGTCATCAGCGCCTACGTCGGCAGCGGACTGCAGCTGTTCGTCGCCGCCACGCTG
CTGTCCTGGCTGCCGAGCTACTTCAACCGCTACTACCACCTCACGACCGCCCAGTCGGGC
AGCGCGGCCGGCGGCTACGCGCTGATCATCGGCGTAGGCATGATCCTCGGCGGTGTCGTA
TCCGACCGGATCAGCGCGGGCGTCTCCATCCGCAAGTGGGCCGTCGCCGTCGGGTGCAGC
CTCGGCTCGCTGGTGCTGCTCACGGTGGCTTTTCAACTCCCCGACGGACCGGTTCAGTTG
GGCGCGCTGGCGTTCGGCGCGCTGCTGTCGGCCGGGTCTGCGGGCCCCGCGGCGGCCATG
GTGGCGAACCTGACCCCCGCGTCCGTCGCCGCGACCGCCTTCGGCACCCTCACCCTGGCC
AACAGCCTGCTCGGCCTGGCGCCCGGACCGGCGCTGACCGGCGTGCTGGCGGACCACGTC
GGCCTGCTGGGCGCCCTGCGCGTGGTGCCCCTCGTCGCGATCGCGGCGACGGCGGCCTTC
CTGGTCGGACGGCACTGGTACGAGCGCGACCTGCTCCGCGTCGGCGGCCTCGCGGCACCG
GCGGCGGAGTCCGAACCCCCCGCGGAGAGGCCCTCATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [47-405]  1.2e-39 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-449]  8.99992502689852e-66 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [37-445]  PS50850
PS50850   MFS
SignalP
 [1-35]  0.354 Signal
Bacteria, Gram-positive   
TMHMM
 [33-52]  Transmembrane (i-o) [67-89]  Transmembrane (o-i) [102-124]  Transmembrane (i-o) [134-156]  Transmembrane (o-i) [163-185]  Transmembrane (i-o) [190-212]  Transmembrane (o-i) [261-283]  Transmembrane (i-o) [298-320]  Transmembrane (o-i) [333-350]  Transmembrane (i-o) [360-382]  Transmembrane (o-i) [389-411]  Transmembrane (i-o) [421-443]  Transmembrane (o-i)
Transmembrane 12