close all open/close all

CDS information : Kirro_00100


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction12,039 / 11,620 / - [in whole cluster]
12,039 / 11,620 / - [in contig]
Locationcomplement(11620..12039) [in whole cluster]
complement(11620..12039) [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative HTH-type regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative HTH-type regulator]
MTTSRPGGRDQRPGERGDLLDPRCPTRRLLDRIGTKWTSMVVKVLAEEAPGELRFADLRR
RVPGISQKMLSVTLRSLVRDGLVARRVEPTVPPAVHYRLTELGLSLEGPLSALRVWAETH
MPEIDRSNRLADEAPSSPT
selected fasta
>[putative HTH-type regulator]
GTGACCACGTCGAGGCCCGGCGGACGTGACCAGCGCCCCGGTGAGCGCGGGGACCTGCTG
GATCCGCGCTGTCCGACCCGCCGGTTGCTCGACCGTATCGGCACCAAGTGGACGTCGATG
GTGGTCAAGGTGCTGGCGGAGGAGGCTCCGGGCGAGCTGCGTTTCGCGGATCTGCGGCGC
CGTGTCCCGGGCATCTCACAGAAGATGCTGTCCGTCACCCTGCGGAGTCTGGTCCGCGAT
GGTCTGGTCGCGCGCCGCGTGGAACCCACCGTGCCGCCCGCCGTCCACTACCGGCTCACC
GAGCTCGGCCTGTCCCTCGAAGGACCGCTCTCCGCCCTGCGGGTCTGGGCTGAGACGCAC
ATGCCCGAGATCGACCGCAGCAACCGGCTCGCCGACGAGGCACCCTCATCCCCCACTTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002577 Helix-turn-helix, HxlR type (Domain)
 [33-123]  2.2e-24 PF01638
PF01638   HxlR
 [24-125]  PS51118
PS51118   HTH_HXLR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [24-106]  1e-15 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP No significant hit
TMHMM No significant hit