close all open/close all

CDS information : Kirro_00110


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction12,143 / 12,994 / + [in whole cluster]
12,143 / 12,994 / + [in contig]
Location12143..12994 [in whole cluster]
12143..12994 [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative hydrolase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative hydrolase]
MPELRRVLANGVELNVALCGSGPAVLLLHGFPHTWELWTDVMADLSGRYRVIAPDLRGFG
ASGRAASGYDAGTLAEDAAALLAALGVSSATVVGIDAGTAPAFLLALRHPGLVRRLVVME
SLLGRLPGAEDFLAEGPPWWFGFHSAAPSLAETVLEGHEAAYVDWFLSAGTLGDGVRPAL
RDAFVRAYTGRQALSCAFSYYRALPKSAVQIEQAVATARLTVPTMALGARPVGAALERQL
RPVTDDLTGHVIDDCGHIIPLHRPHALLALLHPFLAGEDAKAA
selected fasta
>[putative hydrolase]
ATGCCCGAGTTGCGACGCGTCCTCGCCAACGGTGTCGAACTGAATGTCGCCCTCTGCGGA
TCGGGCCCGGCTGTCCTGCTGCTGCACGGCTTCCCGCATACCTGGGAGCTGTGGACGGAC
GTCATGGCCGATCTGTCCGGCCGCTACCGCGTCATCGCTCCGGACCTGCGAGGGTTCGGC
GCGAGCGGCCGCGCCGCCTCCGGGTACGACGCGGGCACCCTGGCCGAGGACGCCGCGGCG
CTTCTCGCCGCGCTCGGCGTGTCCTCGGCCACTGTGGTGGGCATCGACGCGGGCACCGCG
CCGGCCTTCCTCCTCGCTCTGCGCCACCCCGGTCTCGTCCGGCGCCTGGTCGTCATGGAG
TCCCTGCTGGGCAGGCTTCCTGGAGCCGAGGACTTCCTCGCCGAGGGGCCCCCGTGGTGG
TTCGGCTTCCACTCCGCCGCGCCCAGCCTCGCCGAGACCGTGTTGGAGGGCCACGAGGCC
GCCTACGTCGACTGGTTTCTGAGCGCCGGCACACTCGGCGACGGGGTGCGCCCGGCCCTC
CGGGACGCGTTCGTCCGCGCATACACCGGCCGCCAGGCGTTGAGCTGCGCGTTCTCGTAC
TACCGGGCCCTGCCCAAGAGCGCGGTACAGATTGAACAGGCGGTCGCCACTGCCCGCCTG
ACGGTGCCCACGATGGCGCTGGGCGCCCGGCCGGTCGGTGCCGCGCTGGAACGCCAACTC
CGCCCGGTCACCGACGATCTCACCGGACACGTCATCGATGACTGCGGCCACATCATCCCG
CTGCACCGGCCGCACGCCCTGCTCGCGCTGCTGCATCCGTTCCTGGCCGGTGAGGACGCG
AAAGCAGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000073 Alpha/beta hydrolase fold-1 (Domain)
 [48-63]  4.69999810630989e-08 PR00111 [92-105]  4.69999810630989e-08 PR00111 [106-119]  4.69999810630989e-08 PR00111
PR00111   ABHYDROLASE
SignalP No significant hit
TMHMM No significant hit