close all open/close all

CDS information : Kirro_00120


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction14,311 / 13,163 / - [in whole cluster]
14,311 / 13,163 / - [in contig]
Locationcomplement(13163..14311) [in whole cluster]
complement(13163..14311) [in contig]
TypeCDS
Length1,149 bp (382 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MQFGRYPVRWHIVLLTLWTVVWFAVAERHAAVSWHYLRQGEQLLFGQANGGGLALYANHP
ELQIGPVSFLTAGLFAPFPADLGEKLADAFMSGLGLYMLVLVGRAAADHYLGTGVNHKRL
QQRVLIAGAAFIPMWVEVAVRFAHLDDVLALFFTTLAVRALVRGNATAVGALLALAVDSK
PWAVGFLSLLLALPRPARLRAAAWTFGLVAVAWLPFYLTHLETLHAARFTIPNQLASSLR
WFGVDDPRTPWWDRPAQLALGMGLGALAVRRGRWPAVVFLAADARIVLDPSVYTYYNASV
LLGTLIWDSIGQRRLVPWVSWIALISLYGSALLIPSDAARGFIRLAFCLGSAAYVLLWPQ
RPPRGDRRRPAGEPVQGALASN
selected fasta
>[hypothetical protein]
GTGCAATTCGGGCGTTATCCGGTGCGGTGGCACATCGTGCTGCTCACTCTGTGGACGGTC
GTCTGGTTCGCGGTGGCCGAACGGCACGCGGCCGTGTCCTGGCACTATCTGCGCCAGGGG
GAGCAACTGCTCTTCGGCCAGGCGAACGGCGGCGGACTCGCCCTGTATGCCAACCACCCC
GAGCTGCAGATAGGCCCCGTCAGCTTCCTGACCGCCGGACTCTTCGCACCTTTCCCCGCC
GATCTCGGTGAGAAACTCGCCGACGCCTTCATGTCCGGCCTCGGCCTCTACATGCTCGTC
CTGGTCGGCCGTGCCGCCGCCGACCATTACCTCGGCACGGGCGTCAACCACAAGCGCCTA
CAACAACGCGTCCTCATCGCCGGCGCCGCATTCATCCCCATGTGGGTGGAGGTCGCGGTC
CGTTTCGCCCATCTCGACGACGTCCTCGCCCTGTTCTTCACTACGCTCGCCGTCCGCGCA
CTGGTCCGGGGCAACGCGACGGCGGTGGGCGCCCTCCTGGCTCTCGCGGTCGACTCCAAG
CCCTGGGCCGTCGGATTCCTGTCCCTGCTGCTCGCCCTGCCCCGCCCGGCCCGCCTGCGC
GCCGCGGCCTGGACGTTCGGCCTGGTGGCGGTGGCCTGGCTGCCCTTCTACCTGACCCAT
CTGGAAACCCTGCACGCGGCCCGCTTCACGATCCCCAACCAGCTCGCTTCCTCACTGCGC
TGGTTCGGCGTCGACGACCCCCGGACCCCCTGGTGGGACCGCCCCGCCCAGTTGGCCCTC
GGCATGGGCCTGGGCGCACTGGCAGTACGACGCGGACGCTGGCCGGCGGTGGTGTTCCTG
GCGGCCGACGCCCGCATCGTCCTCGACCCGAGCGTGTACACGTACTACAACGCGTCGGTC
CTGCTCGGCACCCTGATCTGGGACTCGATCGGCCAGCGCCGCCTGGTCCCGTGGGTCAGC
TGGATCGCCCTGATCTCCCTGTACGGCAGCGCCCTGCTGATCCCGTCGGACGCCGCCCGG
GGCTTCATCCGCCTGGCGTTCTGCCTGGGCTCGGCGGCGTACGTCCTTCTGTGGCCCCAG
CGCCCCCCGCGCGGCGACCGCCGCCGCCCCGCAGGCGAGCCGGTGCAAGGGGCGCTCGCC
AGCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-30]  0.654 Signal
Bacteria, Gram-positive   
 [1-26]  0.441 Signal
Bacteria, Gram-negative   
 [1-26]  0.858 Signal
Eukaryota   
TMHMM
 [7-26]  Transmembrane (i-o) [86-103]  Transmembrane (o-i) [124-143]  Transmembrane (i-o) [199-221]  Transmembrane (o-i) [314-336]  Transmembrane (i-o) [341-358]  Transmembrane (o-i)
Transmembrane 6