close all open/close all

CDS information : Kirro_00140


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction16,407 / 17,144 / + [in whole cluster]
16,407 / 17,144 / + [in contig]
Location16407..17144 [in whole cluster]
16407..17144 [in contig]
TypeCDS
Length738 bp (245 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[hypothetical protein]
MRRPQARLLAAAALTALTVGVLTACSAVDQKTFQDDAKVSQKITSIRIDSRNGGVEVDAS
GDVSTVTVHRKVDYRGDKRSGTSFSVANGVLTLAGCGDDCGVDYVVKVPAGLPVTGGTTN
GGVTLKGVGAVDVHSSNGEIAVDDARGPVKLRTSNGDVHVKNAKGGGVDTQTSNGEVTIE
ADTPQNIKARTTSGGLTVTAPPADYAISAHDTNGDKKVGFKNDPSGRYRLDLSTTNGDLT
VKSAG
selected fasta
>[hypothetical protein]
ATGCGACGCCCACAGGCACGTCTTCTTGCGGCAGCGGCTCTGACCGCCCTCACCGTCGGC
GTGCTCACCGCGTGCTCGGCCGTCGATCAGAAGACTTTCCAGGATGATGCGAAGGTGTCC
CAGAAGATCACCTCGATCCGTATCGACAGCAGGAACGGCGGGGTGGAGGTGGACGCCTCG
GGGGACGTCTCGACGGTTACCGTCCACCGCAAGGTCGACTACCGCGGTGACAAGCGGAGC
GGCACCTCGTTCAGTGTCGCGAACGGCGTTCTGACGCTGGCCGGCTGCGGCGACGACTGC
GGCGTCGATTACGTCGTCAAGGTGCCCGCGGGACTTCCGGTGACCGGGGGCACGACCAAC
GGTGGCGTCACGCTGAAGGGTGTCGGCGCGGTCGACGTGCACTCGAGCAACGGCGAGATC
GCGGTGGACGATGCCAGGGGACCGGTGAAGCTGCGCACGTCCAACGGCGACGTCCACGTC
AAGAACGCCAAAGGCGGAGGCGTGGACACGCAGACGTCGAACGGCGAGGTGACGATCGAG
GCGGACACTCCGCAGAACATCAAGGCCCGCACGACCAGCGGCGGCCTCACGGTCACGGCC
CCGCCGGCCGACTACGCGATCTCGGCGCACGACACCAACGGCGACAAGAAGGTGGGGTTC
AAGAACGACCCGTCGGGCAGGTACCGCTTGGACCTGTCCACGACGAACGGTGACCTGACC
GTGAAGTCGGCGGGCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025386 Domain of unknown function DUF4098 (Domain)
 [118-179]  2.6e-10 PF13345
PF13345   DUF4098
SignalP
 [1-26]  1 Signal
Bacteria, Gram-positive   
 [1-26]  1 Signal
Bacteria, Gram-negative   
 [1-27]  0.988 Signal
Eukaryota   
TMHMM No significant hit