close all open/close all

CDS information : Kirro_00150


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction18,506 / 19,639 / + [in whole cluster]
18,506 / 19,639 / + [in contig]
Location18506..19639 [in whole cluster]
18506..19639 [in contig]
TypeCDS
Length1,134 bp (377 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative nucleoside-diphosphate sugar epimerase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative nucleoside-diphosphate sugar epimerase]
MTAVAPRNSAGTIQQLSSVNAGDLLGGRPDVVHSREARLLVGARRILVTGAGGSIGSELV
RQLWQLSPASIHLVDHDESALHAIQLDLHGHGLLDDDTVVLGDIRQADAMRELMARVRPH
IVFHAAAHKHLPLLQRYPAQGVLSNVIGTANVVRAAAEAGVDRFIFVSTDKAARPTSVLG
LTKRLGEVIVQAYAGGSMRVGSVRFGNVIGSRGSFLHSLAWQVGNGRPVTLTSPDVTRFF
MTIPQASSLVIEAATMATAGETYILDMGQPVRIADLVDRYVAAVQAPGVEITYTGLREGE
KLHEELLDEKTEQRESTADPRIWCVRPRTAVRPDLLRRVEELGSLVGTVESELLVAAMSN
LLPDAESEDASSLETRP
selected fasta
>[putative nucleoside-diphosphate sugar epimerase]
ATGACCGCGGTGGCGCCACGGAATTCCGCAGGAACGATTCAGCAGCTCTCGTCGGTGAAC
GCCGGCGACCTGCTCGGCGGAAGGCCGGACGTTGTACACAGCCGTGAGGCCAGGCTGCTC
GTCGGTGCTCGACGAATCCTGGTGACCGGCGCGGGCGGATCGATCGGAAGCGAGCTCGTG
CGCCAGCTGTGGCAGCTGTCCCCCGCAAGCATCCACTTGGTCGACCATGACGAGTCGGCC
CTGCACGCAATCCAGTTGGACCTTCACGGTCATGGACTGCTGGACGACGACACGGTGGTT
CTGGGTGACATACGCCAGGCGGATGCCATGCGGGAGCTCATGGCCCGGGTGCGACCCCAC
ATCGTCTTCCACGCCGCCGCCCACAAGCACCTCCCGTTGCTGCAGCGTTATCCCGCGCAG
GGTGTCCTCAGCAACGTGATCGGCACGGCCAACGTTGTCAGAGCCGCGGCGGAAGCGGGG
GTCGACCGCTTCATCTTCGTCTCCACCGACAAGGCCGCCCGCCCCACCTCCGTCCTGGGC
CTGACCAAGCGTCTGGGTGAGGTGATCGTGCAGGCGTACGCAGGCGGATCCATGCGGGTG
GGCTCTGTCCGATTTGGTAACGTCATCGGCAGTCGCGGGTCTTTCCTGCACAGCCTGGCC
TGGCAGGTCGGCAACGGAAGACCCGTCACTTTGACCAGCCCCGACGTCACGCGCTTCTTC
ATGACCATTCCGCAGGCCTCCAGCCTCGTCATCGAGGCCGCGACCATGGCCACCGCGGGC
GAGACCTACATCCTCGACATGGGGCAGCCGGTGCGAATCGCCGACCTCGTCGACCGTTAC
GTCGCTGCCGTGCAGGCCCCCGGTGTGGAGATCACGTACACCGGTCTGCGGGAAGGCGAG
AAGCTGCACGAGGAACTGCTGGACGAGAAGACCGAACAGCGCGAATCGACCGCCGACCCC
CGTATCTGGTGCGTCCGCCCGCGCACGGCGGTGCGCCCCGATCTGCTGAGACGGGTCGAG
GAACTGGGCAGTCTGGTGGGCACGGTGGAGAGCGAACTGCTCGTGGCCGCCATGAGCAAT
CTCCTGCCCGACGCCGAGTCCGAGGACGCGTCCTCGCTGGAGACGCGACCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003869 Polysaccharide biosynthesis protein CapD-like (Domain)
 [46-322]  2.90000000000003e-91 PF02719
PF02719   Polysacc_synt_2
IPR016040 NAD(P)-binding domain (Domain)
 [45-283]  1.80000000000002e-48 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-10]  0.219 Signal
Bacteria, Gram-negative   
TMHMM No significant hit