close all open/close all

CDS information : Kirro_00160


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction19,636 / 20,838 / + [in whole cluster]
19,636 / 20,838 / + [in contig]
Location19636..20838 [in whole cluster]
19636..20838 [in contig]
TypeCDS
Length1,203 bp (400 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative glycosyltransferase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative glycosyltransferase]
MSLNPWIGLAISVLTLPLLFTLVDMVGSVRARNARADYAPPTPVEDFEVLVPIYGSVRYL
ENVDFLRTYGSRVLLCTTTTETDEFNRELDAIAQANGFRVFRGEVSRPSEGRSGKRQTGG
TIRDRVVRDALEWVRAEWVVCLDADTTTVRPLSELVGALAVRKLDLASIRLVPMNTRRLL
GRIQAHEYRLAMQLRRVVPWLVSGACHAARTEAHRQIMRRHSLFFQGNDVELGILANALG
YRVGHVPFEVPTIVPDNFKPWWRQRLAWAGGEVRLYIVNFRFARRHPLVWAYGAATVLLA
PLRWITAAELVNDLGCTMSTAVLGVVMLAYLLLAFYVHWNTRDSVIWLMPLYGAVSSLLI
SPLGILWYVKMARADRNAGIIRPRRPHRAQEPAQSGTQRL
selected fasta
>[putative glycosyltransferase]
GTGAGCCTGAACCCCTGGATAGGCCTGGCCATCTCGGTCCTGACCCTGCCGCTCCTCTTC
ACCCTGGTGGACATGGTCGGCAGTGTGCGGGCCAGAAACGCCCGCGCCGACTACGCACCG
CCCACACCCGTGGAGGACTTCGAAGTCCTGGTCCCCATCTACGGCAGCGTGCGCTACCTG
GAGAACGTGGACTTCCTGCGCACATACGGCAGCCGCGTCCTGCTGTGCACCACCACGACG
GAGACGGACGAATTCAACCGGGAACTGGACGCCATCGCCCAGGCCAACGGCTTCCGCGTC
TTCAGAGGCGAGGTCTCCCGCCCGAGCGAAGGCCGTTCCGGCAAAAGGCAGACCGGCGGC
ACGATCCGGGACCGCGTCGTCCGCGACGCACTCGAATGGGTCCGGGCCGAGTGGGTGGTG
TGCCTGGATGCCGACACCACCACCGTCCGCCCCCTCAGCGAACTGGTGGGCGCACTCGCC
GTCCGCAAACTCGACCTGGCCTCCATACGCCTGGTCCCGATGAACACCCGCCGGCTCCTC
GGACGCATCCAGGCACACGAGTATCGCCTCGCCATGCAGTTGCGAAGGGTCGTCCCATGG
CTGGTGTCCGGCGCCTGCCACGCTGCGCGCACCGAGGCGCACCGCCAGATCATGCGGCGC
CACTCCCTGTTCTTCCAGGGCAACGACGTCGAACTCGGCATCCTGGCCAACGCCTTGGGT
TACCGGGTCGGCCATGTGCCGTTCGAAGTGCCCACCATCGTTCCGGACAACTTCAAGCCG
TGGTGGCGCCAGCGTCTGGCCTGGGCCGGCGGTGAAGTACGGCTCTACATCGTGAACTTC
CGGTTCGCCCGCAGACACCCGCTGGTCTGGGCCTACGGCGCCGCGACGGTCCTTCTGGCC
CCCCTGCGCTGGATCACCGCTGCCGAGCTGGTCAACGACCTTGGATGCACCATGTCCACC
GCGGTCCTCGGTGTCGTGATGCTGGCCTACCTTCTGCTTGCCTTCTACGTGCACTGGAAC
ACCAGGGATTCGGTCATCTGGCTCATGCCGCTCTACGGAGCGGTCTCCAGCCTGCTGATC
TCACCGCTCGGAATCCTCTGGTACGTCAAGATGGCTCGTGCAGACCGGAACGCGGGAATC
ATCCGCCCACGGCGCCCGCACCGAGCACAGGAGCCGGCCCAGAGCGGGACCCAGCGCCTG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-31]  0.974 Signal
Eukaryota   
 [1-31]  0.426 Signal
Bacteria, Gram-negative   
 [1-36]  0.924 Signal
Bacteria, Gram-positive   
TMHMM
 [5-27]  Transmembrane (o-i) [288-307]  Transmembrane (i-o) [317-339]  Transmembrane (o-i) [346-368]  Transmembrane (i-o)
Transmembrane 4