close all open/close all

CDS information : Kirro_00170


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction21,699 / 20,932 / - [in whole cluster]
21,699 / 20,932 / - [in contig]
Locationcomplement(20932..21699) [in whole cluster]
complement(20932..21699) [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative metallo-beta-lactamase family protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative metallo-beta-lactamase family protein]
MSAGTPFTDVDRPLRRPRELDVRWIHGSPSSKHNTDPDIQVYAYDEHTVILRQNMAIDYE
APFLFLLFGATQAVLIDTGATASAEFFPLRRVVDELVDGWLARHPRRDYHLLVLHTHAHA
DHIAGDRQFADRPRTTVVDAELTAAWRHFGFDKDPDAVARVDLGGRVLECLATPGHHEAA
VTFYDPWTGFLLTGDTVYPGRLYVQDWSARTTYQPHEPPLQMTTGHLQDIRAALNEIGDR
PRRLPYPLFVICPDD
selected fasta
>[putative metallo-beta-lactamase family protein]
ATGTCCGCAGGCACACCCTTCACGGATGTCGACCGCCCGCTTCGCCGGCCTCGCGAGTTG
GACGTCCGTTGGATCCACGGCTCACCGTCGTCCAAGCACAACACCGACCCGGACATCCAG
GTCTACGCGTACGACGAGCACACCGTCATCCTGCGGCAGAACATGGCGATCGACTACGAG
GCACCGTTCCTGTTCCTGCTGTTCGGCGCCACGCAGGCGGTGCTGATCGACACCGGAGCC
ACCGCGTCCGCCGAGTTCTTCCCCCTGCGCCGGGTGGTTGACGAGCTCGTCGACGGCTGG
CTCGCCCGCCACCCCCGACGGGACTACCACCTGCTGGTGCTGCACACCCACGCCCACGCC
GATCACATCGCGGGCGACCGCCAGTTCGCCGACCGCCCTCGGACCACGGTGGTCGACGCG
GAGCTCACGGCGGCCTGGAGGCACTTCGGATTCGATAAGGACCCCGACGCCGTGGCGCGA
GTCGACCTGGGAGGCCGCGTGCTCGAGTGCCTGGCCACCCCCGGGCACCACGAGGCAGCG
GTCACGTTCTACGACCCGTGGACCGGGTTCCTGCTCACCGGCGACACGGTCTACCCCGGC
AGGCTCTACGTCCAGGACTGGTCCGCCCGCACCACCTACCAGCCCCACGAACCCCCGCTG
CAGATGACCACCGGCCACCTGCAGGACATCCGCGCCGCGCTCAACGAGATCGGCGACCGA
CCCCGCCGACTCCCCTACCCCCTCTTCGTCATCTGCCCAGACGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001279 Beta-lactamase-like (Domain)
 [61-226]  1.6999992228405e-08 SM00849
SM00849   Lactamase_B
 [67-207]  1.4e-09 PF00753
PF00753   Lactamase_B
SignalP No significant hit
TMHMM No significant hit