close all open/close all

CDS information : Kirro_00180


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction21,765 / 22,031 / + [in whole cluster]
21,765 / 22,031 / + [in contig]
Location21765..22031 [in whole cluster]
21765..22031 [in contig]
TypeCDS
Length267 bp (88 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative zinc dependent dehydrogenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative zinc dependent dehydrogenase]
MRASAAKLPRGRSTPPAMSAPRHVVAVDGHELFLSQVGPRGGAAPGHRFLPDLIRPGRVF
DLIVPLAQVTEGYRAMDERRAVKAHLEP
selected fasta
>[putative zinc dependent dehydrogenase]
TTGAGAGCCTCCGCCGCGAAGCTACCACGCGGTCGGTCGACGCCTCCGGCGATGTCGGCG
CCCCGCCACGTCGTGGCCGTCGACGGACACGAGCTGTTCCTCTCCCAGGTCGGCCCGCGC
GGCGGCGCGGCACCCGGCCACCGCTTCCTGCCCGACCTGATCCGGCCGGGCAGGGTCTTC
GACCTCATCGTGCCCCTGGCCCAGGTCACCGAGGGCTACCGGGCGATGGACGAGCGCCGC
GCGGTCAAGGCCCACCTGGAGCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-26]  0.37 Signal
Bacteria, Gram-negative   
 [1-26]  0.409 Signal
Bacteria, Gram-positive   
TMHMM No significant hit