close all open/close all

CDS information : Kirro_00190


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction22,592 / 22,050 / - [in whole cluster]
22,592 / 22,050 / - [in contig]
Locationcomplement(22050..22592) [in whole cluster]
complement(22050..22592) [in contig]
TypeCDS
Length543 bp (180 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category
Product
Product (GenBank)putative lipoprotein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • It is supposed that this ORF is not involved in kirromycin biosynthesis.
Note (GenBank)

close this sectionSequence

selected fasta
>[putative lipoprotein]
MKTKTTTVALAAIVAAGTAVAAVPASAATAKAAPSRCHTADLKAGFATGDDAKPEMGRPG
KQTQAFVWFTNKSNRTCTLSGFAGVDMVGAQRTDGTWSLVRSSKRPTRITLGRGDTTDFS
INLLPVARSTPQKEKFVPATFLVTPPNETKHFTLKWPFGGQILKQDGATHPGTYLNPVGQ
selected fasta
>[putative lipoprotein]
ATGAAGACCAAAACGACCACCGTGGCCCTTGCGGCGATCGTCGCTGCCGGCACCGCCGTC
GCCGCCGTCCCGGCCTCGGCGGCCACCGCCAAGGCCGCGCCGTCGCGTTGCCACACCGCC
GACCTGAAGGCCGGTTTCGCCACCGGGGACGACGCGAAGCCGGAGATGGGGCGGCCCGGG
AAGCAGACGCAGGCGTTCGTCTGGTTCACCAACAAGAGCAACCGCACCTGCACCCTGTCC
GGCTTCGCCGGTGTCGACATGGTCGGCGCCCAGAGGACCGACGGCACCTGGTCCCTGGTG
CGCTCCTCCAAGAGGCCCACGAGGATCACCCTGGGGCGGGGGGACACGACGGACTTCAGC
ATCAACCTGCTCCCCGTTGCCAGGTCCACGCCGCAGAAGGAGAAGTTCGTCCCCGCGACG
TTCCTGGTCACCCCGCCGAACGAGACGAAGCACTTCACCCTGAAGTGGCCCTTCGGCGGC
CAGATCCTGAAGCAGGACGGTGCCACCCACCCGGGCACGTACCTCAACCCGGTCGGACAG
TAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025326 Protein of unknown function DUF4232 (Family)
 [37-159]  2.5e-18 PF14016
PF14016   DUF4232
SignalP
 [1-21]  0.999 Signal
Eukaryota   
 [1-32]  1 Signal
Bacteria, Gram-positive   
 [1-27]  1 Signal
Bacteria, Gram-negative   
TMHMM
 [7-29]  Transmembrane (i-o)
Transmembrane 1