close all open/close all

CDS information : Kirro_00200


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction22,893 / 23,399 / + [in whole cluster]
22,893 / 23,399 / + [in contig]
Location22893..23399 [in whole cluster]
22893..23399 [in contig]
TypeCDS
Length507 bp (168 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in kirromycin biosynthesis.
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTRIDDTPPAWDERSQLTTFLDYARDTARAKCEGVSAENARKALLPGSPLMTMSGVINHL
RWVEYHWFQVVFLGEEDRGPWTDEDPDREMRIAVEFPLAQLLEEYAEQSARYRELVAGND
LDKRAEGTIRNGLHVDLRWILLHLTEETARHNGHLDILRELLDGTTGI
selected fasta
>hypothetical protein [hypothetical protein]
ATGACGAGAATCGACGACACACCGCCCGCGTGGGACGAGCGCTCCCAGCTCACCACGTTT
CTCGACTACGCACGGGACACCGCCCGCGCCAAGTGCGAGGGTGTCTCCGCGGAGAACGCC
CGCAAGGCGCTCCTGCCCGGCTCACCGCTGATGACCATGAGCGGAGTGATCAACCATCTC
CGCTGGGTCGAGTACCACTGGTTCCAGGTGGTCTTCCTCGGGGAGGAGGACCGGGGCCCC
TGGACGGATGAGGACCCCGACCGCGAGATGCGTATCGCCGTCGAATTCCCGCTGGCGCAG
TTGCTCGAGGAGTACGCCGAACAGAGCGCCCGCTACCGCGAACTGGTCGCCGGGAACGAC
CTGGACAAGCGGGCTGAGGGAACCATCCGCAACGGCCTCCACGTCGACCTGCGCTGGATC
CTGCTGCACCTCACCGAGGAGACAGCCCGCCACAACGGTCACCTCGACATCCTGCGCGAG
TTGCTCGACGGCACGACCGGTATCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR007061 Protein of unknown function DUF664 (Family)
 [16-164]  2.89999999999999e-41 PF04978
PF04978   DUF664
SignalP No significant hit
TMHMM No significant hit