close all open/close all

CDS information : Kirro_00210


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction24,631 / 23,876 / - [in whole cluster]
24,631 / 23,876 / - [in contig]
Locationcomplement(23876..24631) [in whole cluster]
complement(23876..24631) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Productphosphopantetheinyl transferase
Product (GenBank)putative Sfp type phosphopantetheinyl transferase
Gene
Gene (GenBank)kirP
EC number2.7.8.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[21401713] The phosphopantetheinyl transferase KirP activates the ACP and PCP domains of the kirromycin NRPS/PKS of Streptomyces collinus Tu 365. (FEMS Microbiol Lett. , 2011)

close this sectionSequence

selected fasta
>phosphopantetheinyl transferase [putative Sfp type phosphopantetheinyl transferase]
MITGSVGTGLLSALLPSGVAVAELFADPPHIDLHPQEAAVVAGAVDKRRREFAAVRLCAR
AALRRIGATPGPIVPGPKGAPQWPDGVVGSMTHCDGYRAAAVAHRTMFASIGIDAEPHAA
LPEGVEKLTALPEERTALSRLAVTHPRVHWDRLLFSAKESVYKAWFPLTGRWLDFMECAI
TPDPECHTFTADFTVPGPVVGEDRINRFTGRWHAGGDARHVVTAVTVPWPAGKWGGANRS
PESLGVYAGGR
selected fasta
>phosphopantetheinyl transferase [putative Sfp type phosphopantetheinyl transferase]
GTGATCACGGGATCCGTCGGCACCGGATTGCTGAGCGCCCTCCTCCCCTCCGGTGTCGCC
GTTGCCGAACTGTTCGCCGATCCACCGCACATCGACCTGCATCCGCAGGAGGCGGCCGTC
GTGGCCGGCGCGGTCGACAAGCGCCGCCGCGAGTTCGCCGCCGTCCGTCTGTGCGCCCGC
GCGGCGCTGAGACGCATCGGAGCGACACCCGGACCGATCGTGCCGGGCCCCAAGGGTGCA
CCGCAGTGGCCGGACGGGGTGGTCGGCAGCATGACGCACTGTGACGGCTACCGAGCGGCG
GCGGTAGCTCATCGCACTATGTTCGCCTCGATCGGTATCGACGCCGAGCCGCATGCCGCT
CTGCCCGAGGGCGTGGAGAAGCTGACCGCGCTGCCCGAGGAGCGAACGGCACTGAGTCGG
CTGGCGGTCACCCACCCTCGCGTCCACTGGGACCGGCTGCTGTTCAGCGCCAAGGAGAGC
GTTTACAAGGCGTGGTTCCCCCTGACCGGCCGCTGGCTGGACTTCATGGAATGCGCCATC
ACGCCCGATCCGGAATGTCATACCTTCACGGCCGACTTCACCGTGCCCGGACCGGTCGTC
GGCGAAGACCGGATCAACAGGTTCACCGGACGCTGGCACGCCGGGGGTGACGCTCGGCAT
GTCGTCACCGCTGTCACCGTGCCGTGGCCCGCCGGAAAGTGGGGCGGCGCAAACCGGTCG
CCCGAGAGCCTCGGCGTCTACGCAGGAGGACGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003542 Enterobactin synthetase-like, component D (Family)
 [46-66]  6.09999977126211e-27 PR01399 [76-94]  6.09999977126211e-27 PR01399 [153-169]  6.09999977126211e-27 PR01399
PR01399   ENTSNTHTASED
IPR008278 4'-phosphopantetheinyl transferase (Domain)
 [108-185]  6.1e-07 G3DSA:3.90.470.20
G3DSA:3.90.470.20   G3DSA:3.90.470.20
 [110-179]  1.9e-13 PF01648
PF01648   ACPS
 [107-229]  1.39999892049878e-12 SSF56214
SSF56214   4-PPT_transf
SignalP
 [1-26]  0.996 Signal
Bacteria, Gram-positive   
 [1-26]  0.99 Signal
Eukaryota   
 [1-22]  0.999 Signal
Bacteria, Gram-negative   
TMHMM No significant hit