close all open/close all

CDS information : Kirro_00220


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction25,016 / 30,997 / + [in whole cluster]
25,016 / 30,997 / + [in contig]
Location25016..30997 [in whole cluster]
25016..30997 [in contig]
TypeCDS
Length5,982 bp (1,993 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)kirAI
EC number
Keyword
Note
Note (GenBank)
  • trans-AT polyketide synthase architecture
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

0
1
2
ACP292..365
KS386..757
KR1113..1313
ACP1393..1462
KS1516..1885

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MLGLPTLATGGLSENWLLRESGDLHWSLIGEYFGTSVTKLADADGTRLLPAFVRVRHTAS
ASLAAFAELDEGEMSGELTRLDDRRFLSDIRFATGTAHVDVRLLTVFVRRSDRNWLVPGV
PQLPGCLPAREPDADQLAFLHDFQEQSGRHTDGPGLHTERYELNPVVDVNALGLLYFASY
PHINDHGERRYLHSLAPGGEWATAATTVRRDIVYLANCGAEDTVRYRLDDLRLEDGHRAV
LTSTLLREADNRPLARIETVKALRGSSVFGGLWGDSVAPRAAPAPREPAPATDDALETVL
LQLLERALGRPAGSLTADDDLRRYGLDSVALAEIVALAHDEHGLQIDPSAMFQAFTVEAM
AQVIRGEDREPRPVTATAAPKPGASAPIAVIGMAGRFPGAASVSELWDLLGRDEDAIRDI
PIDRWDTAAHPDLVGRAALLDDIRRFDHEFFAVSPREAALMDPQQRLMLEVAWATAEDAG
QDPTKLSGSRTGVYTGVCHSDYATVLAEHAGRDEPHLSVAVSPSLVANRVSYALGLRGPS
VTVDTLCSSSLVAVAQAIAALRAGACDQAFAGGVNVLCDPGRHAAYQRAGVLSPRGRCHT
FDDDADGYVRGEGACALLLKPLDRALADGDRVHAVIREVAVNHGGQAQSFTAPNPEAQAD
LLVSAYTTAAVDPATVGYLEAHGTGTRLGDPIEVSAMVAAFRRLYAHSRHPMPDAPHCGI
GSLKTNIGHLEAAAGVAGMIKVILALRHRTLPATRNVRRTNRMINLSGSPLRLQLEQAAW
EPPPGGGPRRAGVSSFGMGGTNAHVVLEEAPPAAGAPPVGRVTVPVSARTPQALRDALVA
LLDVVRSPQAPPLASIARTMSTGRARLACRVAVTAADLGELADALAAAVDAEPLTGDAGT
EGPVPAAPVVSLPSYPFRRDQHWAAPTAVPQSPSPAPQFLTAAWQDAPPPAPAQRGRFLV
LTTDPSLATTLFGDDAVAHRPGDPLPTVRGLAGVADLVDWGEPGALVTERIQVLREVLGR
HPRTGLRCLHVSGARRSALAGFYRAVSGELPMVVSRTVRVDGDLADLAAAVAAESTADDQ
ETEIRYAGSRRRRSVAGFARPGDVDPLTGLDRGAVLITGGTGAIGLRLAEHLADRGARHL
VLIGRSELPARNRWASLAAEPSTDPLLRTRLTALLALAERGVKLSVHTHALNDAVTLRRL
INRHRGRAGGIAAAFHCAGVMHQPRSFLAKTADEIAVVLRPKLAVETLWAAFGSRLPRLM
VLFSSIAAGSPRLAGGYLDYAAANNVLDDFAEAHADEPGCVVRSLRWPLWRDVGMGERRT
SAGTELGIPDLAEGDALRLLDLALRVPGEPVLLPCLTRRTAVPADELFRAPRRDPDPAPE
PVTAPADEPDAAEIDWLADVVARTTRTERSLLRPDTHLVDLGVDSLLMAELVRDLEAALG
DVVDPSLLQDHPTLARLAAALTAAGARAPATGPVASAAERVPATGPVASAAERAPATAPV
ASAAPARTSAADGAATRIAVIGMGCRLPGAADPEQLWQALLAGRDLVGDVPADRWDTTAL
YRPDGGPGFSQSRWGGFLDDAALFDPGYFGFDDETARQLDPLIRKTLEVAVECVHDAGYT
AEELRGRRVGVFVGGRTGNHRAHLRPLTRESIVGINQNYIAAHVSHFLDLAGPNLVIDSA
CSSALVSVHLAAQSLMLGESEMALAGGVDLLLDEEPYLMLSAGKALSPTGRCRTFDESAD
GFVPGEGAGLVLLKRLDAAERDGDRILAVIEASGVNNDGRTMGHTTPNGAAQRALISEVL
ARGGIDARTIGYVEAHGTGTMIGDPIELQALTTVYRQHTGDREYCGIGSVKSSMGHLLSA
AGIAGFIKAVQTLRHGLIVPTLHCERPNPRFAFGESPFFPARTTTELPAGSRVAVSAFGF
GGTNAHVVLGPGAPEGTGRAPLPSPEYRRRRFWHHRAGILTTPARPAARPVRSARLDLTV
TPVAAPALDRSHR
selected fasta
>polyketide synthase [putative polyketide synthase]
GTGCTGGGCCTGCCGACGCTCGCCACCGGTGGCCTCTCCGAGAACTGGCTGTTACGCGAG
TCCGGCGACCTGCACTGGTCGCTGATCGGTGAGTACTTCGGCACCTCGGTCACCAAACTC
GCCGACGCCGACGGCACCCGGTTGCTTCCGGCCTTCGTCCGGGTCCGCCACACCGCGAGC
GCCTCGCTCGCCGCCTTCGCCGAGCTCGACGAAGGCGAGATGAGCGGTGAACTGACCAGA
CTGGACGACCGGCGGTTCCTGTCCGACATCCGCTTCGCCACCGGCACGGCACACGTCGAC
GTCCGGCTGCTCACCGTTTTCGTCCGCCGCTCGGACCGCAACTGGCTGGTTCCCGGCGTG
CCACAGCTGCCCGGCTGCCTGCCGGCCCGGGAGCCGGACGCCGACCAGCTGGCCTTCCTG
CACGACTTCCAGGAGCAGAGCGGTCGCCACACGGATGGTCCCGGACTGCACACCGAGCGT
TACGAGCTCAATCCGGTCGTCGACGTCAACGCCCTCGGCCTGCTCTACTTCGCCTCCTAC
CCGCACATCAACGACCACGGCGAGCGCCGGTACCTGCACTCGCTGGCACCAGGCGGCGAG
TGGGCCACCGCGGCCACCACCGTCAGACGCGACATCGTGTACCTGGCGAACTGCGGCGCC
GAGGACACCGTGCGGTACCGGCTGGACGACCTGCGTCTGGAGGACGGTCACCGGGCGGTG
CTGACCTCGACGTTGCTGCGCGAGGCCGACAACAGGCCGCTGGCCCGGATCGAGACGGTC
AAGGCACTGCGCGGGTCCAGCGTGTTCGGCGGGCTCTGGGGTGACTCCGTCGCGCCCCGC
GCCGCGCCGGCCCCGAGGGAACCCGCGCCCGCGACCGACGACGCCCTGGAAACGGTGCTG
CTGCAGCTGCTGGAACGGGCGCTCGGACGGCCGGCCGGTTCCCTGACCGCCGACGACGAC
CTGCGGCGGTACGGCCTGGACAGCGTCGCGCTTGCCGAGATCGTGGCGCTGGCCCATGAC
GAACACGGCTTGCAGATCGATCCCAGCGCCATGTTCCAGGCCTTCACCGTCGAGGCCATG
GCGCAGGTGATACGCGGCGAGGACCGCGAACCCCGACCGGTCACCGCCACGGCCGCACCG
AAGCCGGGCGCCTCGGCACCGATCGCGGTGATCGGCATGGCCGGACGCTTCCCCGGGGCG
GCCAGCGTGAGTGAACTGTGGGACCTGCTCGGCCGCGACGAGGACGCGATCCGCGACATC
CCGATCGACCGCTGGGACACCGCCGCGCACCCGGATCTGGTGGGCCGGGCGGCCCTGCTC
GACGACATCCGCCGCTTCGACCACGAATTCTTCGCCGTCAGCCCCCGCGAGGCCGCGCTG
ATGGATCCCCAGCAGCGGCTCATGCTCGAGGTGGCGTGGGCGACCGCCGAGGACGCGGGA
CAGGACCCCACCAAGCTGTCGGGCAGCCGGACCGGTGTGTACACCGGGGTCTGCCACTCC
GACTACGCCACCGTGCTGGCCGAGCACGCCGGTCGCGACGAACCGCACCTGAGCGTCGCG
GTCTCTCCTTCGCTGGTGGCCAACCGGGTCTCGTACGCCCTGGGCCTGCGCGGCCCGAGC
GTCACCGTGGACACACTCTGCTCGTCGTCGCTGGTCGCGGTGGCCCAGGCCATCGCGGCG
CTGCGGGCCGGAGCATGCGACCAGGCCTTCGCGGGCGGCGTCAACGTGCTGTGCGACCCG
GGACGGCACGCGGCGTACCAGCGCGCCGGCGTACTGAGCCCACGCGGACGCTGCCACACC
TTCGACGACGACGCCGACGGCTACGTCCGCGGCGAGGGGGCATGCGCGTTGCTGCTCAAA
CCCCTCGACCGGGCGCTCGCCGACGGCGACCGGGTGCACGCGGTCATCCGCGAGGTGGCG
GTCAACCACGGTGGGCAGGCGCAGTCGTTCACCGCGCCCAACCCCGAGGCCCAGGCCGAC
CTGCTGGTCAGCGCCTACACCACGGCGGCCGTCGACCCCGCCACCGTCGGCTACCTCGAG
GCGCACGGCACCGGTACCCGGCTGGGCGACCCGATCGAGGTGTCGGCCATGGTGGCGGCG
TTCCGCCGGCTGTACGCGCACAGCCGGCATCCGATGCCGGACGCACCACACTGTGGCATC
GGATCCCTCAAGACCAACATCGGTCATCTGGAGGCCGCCGCCGGTGTCGCCGGCATGATC
AAAGTCATTCTCGCCCTGCGCCACCGGACGCTGCCGGCCACCCGCAACGTGCGCCGGACG
AACCGCATGATCAACCTGTCCGGTTCGCCGCTGCGGCTCCAGCTGGAACAGGCCGCGTGG
GAGCCGCCGCCCGGCGGCGGCCCCCGCCGGGCCGGGGTCAGCTCGTTCGGCATGGGCGGC
ACGAACGCGCACGTGGTCCTGGAGGAGGCACCGCCGGCAGCCGGGGCACCGCCGGTCGGC
CGGGTGACGGTGCCCGTGTCGGCCCGCACCCCGCAGGCACTGCGGGACGCGCTCGTCGCG
CTGCTGGACGTGGTGAGGTCACCGCAAGCGCCCCCACTCGCCTCGATCGCCCGGACGATG
AGCACCGGCCGGGCCCGGCTGGCCTGCCGCGTCGCCGTCACGGCGGCAGACCTCGGCGAA
CTCGCGGACGCGCTGGCCGCCGCCGTCGACGCCGAGCCGCTCACCGGCGACGCCGGGACC
GAGGGCCCGGTGCCTGCCGCCCCCGTCGTGTCGCTGCCGAGCTACCCCTTCCGGCGGGAC
CAGCACTGGGCGGCGCCCACCGCCGTGCCGCAATCGCCTAGCCCCGCCCCGCAGTTCCTC
ACCGCGGCCTGGCAGGACGCGCCGCCACCCGCGCCGGCGCAGCGCGGCCGTTTCCTGGTC
CTCACGACGGACCCGAGCCTCGCGACGACGCTGTTCGGCGACGACGCCGTCGCGCATCGC
CCCGGCGATCCGCTGCCCACCGTGCGGGGCCTGGCCGGCGTCGCCGATCTGGTCGACTGG
GGAGAACCGGGCGCTCTGGTCACCGAGCGGATCCAGGTGCTGCGCGAGGTGCTCGGCCGG
CATCCGCGCACCGGCCTGCGCTGCCTGCACGTCAGCGGCGCTCGCCGCTCGGCGCTGGCC
GGCTTCTACCGCGCCGTCTCCGGAGAACTGCCCATGGTCGTCTCCCGCACCGTCCGGGTC
GACGGTGACCTCGCCGACCTGGCCGCCGCGGTCGCGGCCGAGAGCACGGCCGACGACCAG
GAGACCGAGATCCGGTACGCCGGCTCCCGACGACGGCGCAGCGTGGCCGGGTTCGCCCGG
CCCGGCGACGTCGATCCGCTGACCGGTCTCGACCGGGGCGCCGTGCTGATCACCGGGGGC
ACCGGTGCCATCGGCCTGCGCCTCGCCGAGCACCTGGCCGACCGGGGTGCGCGGCACCTC
GTCCTGATCGGCCGCTCCGAGCTGCCCGCCCGCAACCGCTGGGCGTCCCTGGCCGCCGAG
CCGTCGACCGACCCGTTGCTGCGCACGCGCCTCACCGCCCTGCTGGCCCTCGCCGAGCGG
GGCGTGAAGCTCTCGGTCCACACCCATGCGCTGAACGACGCGGTCACGCTGCGCAGGCTG
ATCAACCGGCATCGAGGCCGCGCCGGAGGGATCGCGGCGGCCTTCCACTGCGCGGGGGTC
ATGCACCAGCCCCGGTCGTTCCTGGCCAAGACGGCCGACGAGATCGCCGTCGTGCTACGG
CCCAAGCTCGCCGTGGAGACACTGTGGGCTGCGTTCGGCAGCCGGCTGCCGCGCCTCATG
GTCCTGTTCTCCTCGATCGCGGCCGGGTCGCCCCGGCTGGCCGGGGGCTATCTGGACTAC
GCCGCGGCCAACAACGTCCTCGACGACTTCGCCGAGGCGCACGCGGACGAGCCCGGGTGC
GTGGTCCGGTCGCTGCGGTGGCCGCTGTGGCGGGACGTCGGAATGGGCGAGCGGCGTACC
AGCGCCGGGACCGAACTGGGCATCCCCGACCTGGCGGAGGGCGACGCGCTGCGACTGCTC
GACCTGGCGCTGCGGGTGCCGGGCGAACCGGTGCTGCTGCCCTGCCTGACGCGCCGGACC
GCGGTGCCGGCCGACGAACTGTTCCGGGCGCCCCGGCGCGACCCCGATCCCGCCCCCGAG
CCGGTCACCGCCCCGGCGGACGAGCCGGACGCGGCCGAGATCGACTGGCTGGCCGACGTC
GTGGCCCGGACAACCCGCACCGAACGGTCCCTGCTGCGGCCCGACACCCACCTCGTCGAC
CTCGGTGTGGACTCGTTGCTGATGGCCGAGCTGGTCCGCGATCTCGAGGCAGCACTCGGC
GACGTCGTGGACCCCAGCCTGCTCCAGGATCACCCCACACTGGCCCGGCTCGCCGCCGCG
CTCACCGCCGCGGGAGCGCGTGCCCCGGCCACCGGCCCGGTGGCGTCCGCGGCAGAGCGT
GTTCCGGCGACCGGCCCGGTGGCCTCCGCGGCGGAGCGTGCCCCGGCCACCGCCCCGGTG
GCATCCGCGGCGCCGGCACGGACGTCCGCCGCGGACGGTGCCGCGACGCGGATCGCGGTC
ATCGGGATGGGCTGCCGACTGCCCGGCGCAGCCGACCCGGAGCAGCTCTGGCAGGCACTG
CTCGCCGGGCGGGACCTGGTCGGCGACGTGCCGGCGGACCGCTGGGACACCACGGCCCTC
TACCGGCCGGACGGCGGACCCGGGTTCAGCCAGAGCCGGTGGGGCGGCTTCCTCGACGAC
GCCGCCCTGTTCGACCCGGGCTACTTCGGCTTCGACGACGAGACGGCACGTCAACTCGAC
CCCCTGATACGCAAGACGCTCGAGGTCGCCGTCGAGTGCGTGCACGACGCCGGGTACACC
GCTGAGGAGTTACGTGGCCGCCGGGTCGGAGTCTTCGTCGGCGGCCGGACGGGCAATCAC
CGCGCACACCTGCGGCCGCTGACCCGCGAGTCGATCGTCGGGATCAACCAGAACTACATC
GCGGCGCACGTGTCGCACTTCCTCGACCTCGCCGGGCCGAACCTCGTGATCGACAGCGCC
TGCTCGTCGGCGCTGGTCAGTGTGCACCTGGCCGCGCAGAGCCTGATGCTGGGCGAGTCC
GAGATGGCACTGGCCGGCGGTGTGGACCTGCTGCTGGACGAGGAGCCGTACCTGATGCTC
AGCGCCGGCAAGGCGCTGTCACCGACCGGACGCTGCCGCACCTTCGACGAGTCCGCCGAC
GGCTTCGTCCCGGGCGAGGGCGCCGGGCTGGTGCTGCTGAAGCGTCTCGACGCCGCCGAA
CGCGACGGCGACCGCATCCTCGCGGTCATCGAAGCGTCCGGTGTCAACAACGACGGCCGC
ACCATGGGCCACACCACCCCGAACGGGGCCGCCCAGCGGGCGCTGATCAGCGAGGTGCTC
GCCCGCGGCGGCATCGACGCGCGCACCATCGGATACGTCGAGGCGCACGGCACCGGCACG
ATGATCGGCGACCCGATCGAGCTGCAGGCGCTGACCACCGTCTACCGGCAGCACACCGGC
GACCGGGAGTACTGCGGGATCGGCAGCGTCAAGAGCTCGATGGGCCACCTGCTCAGCGCC
GCCGGGATCGCCGGATTCATCAAGGCCGTGCAGACGCTCCGGCACGGACTGATCGTCCCG
ACCCTGCACTGCGAGCGACCCAATCCGCGGTTCGCGTTCGGCGAGTCACCGTTCTTCCCC
GCACGGACCACGACCGAACTGCCCGCCGGCAGCCGCGTCGCGGTCAGCGCCTTCGGATTC
GGCGGCACCAACGCCCACGTCGTACTCGGCCCCGGCGCCCCCGAGGGGACCGGGCGGGCT
CCGCTGCCCTCACCGGAGTACCGGCGCCGCCGGTTCTGGCACCACCGCGCCGGGATCCTC
ACGACTCCCGCCCGCCCCGCCGCGAGACCGGTCCGGTCGGCGCGCCTCGATCTCACCGTC
ACGCCGGTCGCGGCCCCCGCGCTCGACCGTTCCCACCGCTGA
[0] ACP292..365
[1] KS386..757
[1] KR1113..1313
[1] ACP1393..1462
[2] KS1516..1885
[0] ACP874..1095
[1] KS1156..2271
[1] KR3337..3939
[1] ACP4177..4386
[2] KS4546..5655

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [323-338]  PS00012 [1420-1435]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [300-363]  3.5e-11 PF00550 [1395-1461]  1.4e-11 PF00550
PF00550   PP-binding
 [288-368]  1.5e-26 G3DSA:1.10.1200.10 [1395-1463]  7e-27 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [292-365]  PS50075 [1393-1462]  PS50075
PS50075   ACP_DOMAIN
 [289-402]  2.800005042611e-22 SSF47336 [1386-1499]  2.19999900980708e-17 SSF47336
SSF47336   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [1113-1313]  8.79999999999995e-34 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [386-624]  1.29999999999998e-78 PF00109 [1516-1759]  5.69999999999998e-77 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [633-757]  1.9e-38 PF02801 [1767-1885]  8.10000000000001e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [386-636]  G3DSA:3.40.47.10 [639-812]  6.29999999999998e-111 G3DSA:3.40.47.10 [1516-1770]  G3DSA:3.40.47.10 [1773-1930]  6.29999999999998e-111 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [378-812]  1.79999754022378e-84 SSF53901 [1508-1931]  1e-88 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1110-1151]  3.39999999999999e-20 G3DSA:3.40.50.720 [1183-1317]  3.39999999999999e-20 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1672-1688]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [297-368]  4.60000044330862e-06 SM00823 [1394-1465]  9.00000407957274e-11 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [388-812]  SM00825 [1518-1934]  SM00825
SM00825   PKS_KS
SignalP No significant hit
TMHMM No significant hit