close all open/close all

CDS information : Kirro_00230


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction31,022 / 44,176 / + [in whole cluster]
31,022 / 44,176 / + [in contig]
Location31022..44176 [in whole cluster]
31022..44176 [in contig]
TypeCDS
Length13,155 bp (4,384 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)kirAII
EC number
Keyword
Note
Note (GenBank)
  • trans-AT polyketide synthase architecture
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[23083014] Poly specific trans-acyltransferase machinery revealed via engineered acyl-CoA synthetases. (ACS Chem Biol. , 2013)
[24726832] Reprogramming Acyl Carrier Protein Interactions of an Acyl-CoA Promiscuous trans-Acyltransferase. (Chem Biol. , 2014)
[24871074] Comparative analysis of the substrate specificity of trans- versus cis-acyltransferases of assembly line polyketide synthases. (Biochemistry. , 2014)

close this sectionPKS/NRPS Module

2
3
4
5
DH16..155
ACP301..371
KR582..743
KS850..1215
KR1697..1864
MT2121..2224
ACP2329..2398
KS2433..2802
KR3171..3347
ACP3435..3504
KS3557..3936
ACP4212..4281

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MNRLAARCLLRLTGDNPIVDDHRVHGVRTLPGVTFLDIVYRLLRERGVEPGDAGLSDILF
VEPLTTTEDFDREVTVLLEPDGDITHVTATSRRVRDGAPADDGRTTHVRAVLRVGLPALT
GSPLPAGAAPPRDIGEVYTIGRSAGIEHRDFMRCHGTMRVEADTVRARLALGAEARATST
DFMLHPALLDGSTMQAYALAFAGDGADERPLIPLHIGEFRAVRPLGDTCTVEMRLTSAGP
AADIVKADIDLYDASGAPAARFTGLVLKRVRSTEAITRLTASRAAAPAPVAAPTPTPGAS
LRAEIVELVRQVAADPDLLEVEGDRGFYDLGLESTDLLALVRSFEERWNITLYPTLLFEY
PTVDAVTEHLAGLIPDRPRAEAPPPDDTPATTACLTGTWQPAARPDPPSIGSLLVIGDAR
LRPDQITARRGPAFRRLGEREYELRPSAPDDLRALLADLPGAPDSVVHLAPRADADPAEG
VETACREMLALARVLLDAPVPVVHVAQPLVAAAVAGMARTIRLEQPRLAVTAVECVGDPD
PRAVLAELSGHGETWVRHDGGRLVRRYRDAAPGGARPLRSGGVYLITGGAGGLGRALAAS
FTAQGATVVLAGRTPSKQVPNAEFVRADVTMAADVRALVDGVVARHGRLDGVVHAAGVLR
DGLLAGKSPEDLSAVLAPKVRGTLLLHDATRHLGLDFFVAFSSVTGVAGNVGQADYAAAN
AFVDACAREYGFTSVAWPLWADGGMRTDAATEAVFRRQGQVPLPTGAGLAVFDAIRDQRG
GEVVVLHGRPDRARRALELREPETGSVATEPEPSVATEPEPSLTAVRDAAATTVREPLAA
TAGDPRPSGRDIAVIGVAGRYPMAPDLDRFWANLLDGRDCVTEIPEQRWRPAGFFEPERA
AGRSYSKWGAFLDGIDEFDPAFFRITPREAEGMDPQERLFLQTAWHALEDAGIPRAAVAG
RPVGVFAGVMFTQYQMLGLGAEERLPVLPTSFTSAVANRVSYFLDARGPSLALDTMCSSS
LTALHLACESLRSGESELALAGGVNLIVHPYKYLHLSQVGFVSSDGRCRAFGAGGDGYVP
GEGVGVVVLKPLAAAVADGDRVLGVIKGSAVNHGGRAGGFYVPNPTAQADVIRQALDRAG
VDPATVSYLEAHGTGTALGDPVEISALSQVFAAGDTRLGSVKSGIGHLESAAGIAGLTKV
LLQLRHRTLVPSLHARPANEAIDWERSPLSVQQDAGPWHTTGDVPRRAGISAFGAGGSNA
HVVVEEYSTPAPGTTDGPQVVLLSARTPRALRLLAERYAELPAGDQVADLADAAGFPDAD
RDAPFEELGLDADDLRRLMRAVAARSQGQPPRVDAQSSLSALAAALDGAVPLADIAHTTQ
AGRDAMAERLAVVATDVEELRTALRGFLNGDESRVHRGRATEPVDTPASADPDTLAAAWV
KGAAPDWGVLHRERRPRKTSLPGYPFERVRCWVGTGTDATGATGRGTADAPAAAAPRPAQ
VSLGADVPRWEPCPAPEPVTPDGPVVVLYAPERTGLAAELAARHPGAQRVEIGGPVTVDP
RVVYLLTGPAPTDGCEASRVAGGEAAGVRALAGYARRWARLPEIDWIVVTAGAAAAPGRR
LTDPYAAGVHGFARVLENEHRGWSVAVVDLDPAHLTADVLVPARRGTRIACTGTTAHRQV
LGEAPAPHGPELLRRGGRYLIVGGGGGIGLALARKLVVEWDAEVVLVGRRERPDLAAEHR
IRYLRADASDAGQLTAVLEQAGPVHGIMHAAMAQRSRLVRDLSDDDLAESLTAKSGVAAA
LVDTIDATDLDFLLFFSSAQSFLGEPGLAGYAAGSTFLDAYAHTLDERLPYPVRAVDWGF
WGTVGSVATEKHRAELTAAGFHSITPDTGLTALTEALRRPAPQLLVVPGTAALRERMTPS
EGTTPAVTPAEGLLTSADLRVVDDFHAVDEKMSAIARGALLAVLHEMGAWQGPDPDAAEV
ARRVGVTPRYDRLLHTLLTMLADDGVLTVHQNRFRPDRAALAEALAGGHAERLGELAAAH
PASAVFVELLRRCLDRYPMLLRGELLATDLLFPASGTSAMERIYRDNPISDLYNDVLTAR
LLEHVGRRRDRLRPGERIRIVEVGSGTGGTTAGLLRALAPHGEHLEYWYTDLSAAFLAHG
RREFGARYPFVRFKRLDLDTDPVTQGFPADAFDIAVGANVLHATSDVSRAVRHLRTVLRT
GGRLLLNELTTVTLAATVTYGLFDGWWAHTDAHLRLPGSPLLDVAGWSAVLTGAGYDGFR
ALPTDGETSRNFQHVVVATAAARATEPAPGTASGRVAAQRAPEDDGASFTAELLALTSEA
SGIPVEDLDLDTEIGDYGFDSVSYGLLAGRLNDTFGLDVTPALFYETATLRALVARLDRD
YGATLRERYARTVPEATEAEAPPRSAPQTGPDDPIAVIGMAARLPGSRDLDDFWNHLVAG
DDLVTDVPADRWDWRSLPPDVLARRGGFISDVDMFDPLFFGISPQEAAGMDPQQRLLLEG
VWTALEDAGLPPGTLAGWPVGLFVGAGSSDYDEIRRRSDVPVDAHAATATAHSILVNRVS
YLLDLRGPSEPVNTGCSSSLVAIHRAAAAIRSGECDIAVAGGINLILSPHNHLLLSRTGM
LSPSGRCRAFDARADGFVRGEGLGLVVLTRFGAAGRHRVRGLLRGSAVNHGGRARSLTAP
NPAGQAAMIVRAHTEAGVDPATVGYLETHGTGTELGDPVEINGLRLAFEELAGRHAGLPG
APFCGLGAVKANIGHLESAAGIAGLLKVLLAMRHGILPPVAGLGEPNPHLRLEGSPFQLI
RRATPWHRPPGGGRRRAGISSFGYGGVNAHVVVEEPAEPAVPAAPAGPLVFPLSARTPEA
LRRYATALRAALDSDVELVDVAHTLQHGRDAMSERLAVTAVDRPTLLAALGAAIDGTGHP
ALAHPGGVTPADRWVAGAEAAWPDTGGTLIPLPTYPFERRRCWIGARPQEPDAPGAPVGV
YAPRWQRIADAGTRPSADGPVWLLGGDDYPASDVHRVTSTSLDALPTPTVVHAVVTGGEP
AVRELFRVIRHLQTRPAGAGELTLTVVTRAAAAVDGPITDPVAAAAHGLVKSARRECERW
RISAIDVGPGDDTTVAAATPGDYALRSGRWHQRVLRPLDDTGARPVFRDGGTYVLVGGAG
DVGLDLAEHLVREHRAKVVLIGRTRPDGARADRIASFDPAGTSVEFHQADARDAERLRAV
FDRVGVIHGVVNAATVARDRSLAALDEDWFAEGLNAKTRTTLAVAEAIGGRDLDFFAVFS
SLQSFLGNPGQAAYAAACTAQDAIGQALAARSPFPVRVLNWGPWSGSALTERHRDRLAAA
GLHPLPPRTGIEALAGVLGRQEVQVAVVSGTEQALAGIGVPTPDPEPAPPAVTSAVVQPV
AQPVPPSAEPWRAAVAADLLALVRGVAGLGAAELTENDQLSRFGFDSIMYTRLSHQVNVR
WDLDATPAAFFGVATAGELVAKITAEYGEELARHYRPAASTAPAVPPATAVPPGPVASPG
PIAGTGAAGVAQPAGTDDVAIVGMAGLLPGSDDLDEFWAHLAAGDDLVTEIPADRWDWRR
IHGDPEPGEFRTTARWGGFLRRVDLFDADFFGISPTEAVAMDPQHRLVLETTWTAIEDAG
IRPSDLAGTDTGVFVGSSTYDYFELQHALGVPLDGYNTVGRAHAILSNRVSYLLDLHGPS
ETLDTACSSSLVAVHHAAEAIRRGECTVALAGGVNVIASPTLFVDMSQADMLSPDGRCRA
FDARANGIARAEGAGVVVLKRLSAALVDGDVIHGVLRGSAVNHGGRGNSLTAPNPAAQAD
CIVAAHRRAGTEPRTVTYVETHGTGTELGDPVEIEGLKTAFRRLYADHGTDGTDHRVALG
AVKSNTGHLEAAAGVTGLIKVLLAMRHRELPGNPHLEKLNPHLRLDGSPLHVLRDREPWR
RVTGPDGTEAPLRAGLSSFGLGGVNAHLVLEEFRTRPSAGRSGPYLFVLSARDAERLRGN
AEHLVRWARDADEVDPAALAYTLQTGREVFAERLAVVADDLAGLVKRLEEWLAGATADGV
SAGDGRGTGTALLLDGPEGRQYLRTVVAAGKLDKIARLWVDGVDIDWAELWPGEPMRRVP
APTSAFARQSYWITPGPRFDQAQAEAAGLAGTAQDEVTETWPEPAAAVPAPPAESAPAPA
ATAAGGDPESAVRDHVRTLLAAHLGMAPDRLPPDRVLSDVGVDSLGLRRLSRRLGATYGV
DIPARMFGVGQTVRALARAVHDKYGPLPATATPEPPPAPVTSSATAPEPTSVPVASSAAA
PAPIPAPVAPSAAAPAPVASSAAAPEPPPAPVAADAVGALLAGLRDGSVTVDDALAELRQ
GNVR
selected fasta
>polyketide synthase [putative polyketide synthase]
GTGAACCGTCTGGCTGCTCGCTGCCTTCTCCGGCTGACCGGGGACAACCCGATCGTCGAC
GACCACCGCGTGCACGGGGTGCGCACACTGCCCGGCGTGACCTTCCTCGACATCGTGTAC
CGCCTGCTCCGCGAGCGCGGTGTCGAGCCGGGCGACGCCGGGCTCAGTGACATCCTCTTC
GTCGAACCCCTCACCACCACCGAGGACTTCGACCGGGAAGTCACGGTCCTGCTGGAGCCC
GACGGCGACATCACACATGTCACCGCGACCAGCCGGCGTGTGCGCGACGGCGCCCCGGCC
GACGACGGGCGGACCACGCATGTACGGGCCGTCCTCCGCGTCGGCCTGCCGGCCCTGACC
GGATCACCGCTCCCGGCGGGAGCCGCGCCACCGCGCGACATCGGCGAGGTCTACACGATC
GGCAGGTCGGCCGGGATCGAACACCGCGACTTCATGCGCTGTCACGGCACGATGCGGGTC
GAGGCCGACACGGTGCGGGCGCGGCTCGCTCTCGGTGCCGAGGCGCGGGCCACGTCGACC
GACTTCATGCTGCACCCGGCCCTGCTCGACGGGTCGACCATGCAGGCGTACGCGCTGGCC
TTCGCCGGGGACGGAGCCGACGAGCGGCCCCTGATCCCCCTGCACATCGGAGAGTTCCGC
GCGGTGCGGCCGCTCGGCGACACCTGCACGGTGGAGATGCGGCTCACCTCGGCGGGCCCG
GCCGCCGACATCGTCAAGGCCGACATCGACCTGTACGACGCCTCGGGCGCGCCGGCCGCC
CGATTCACCGGCCTGGTCCTCAAACGGGTCCGCTCCACCGAGGCGATCACCCGGCTCACC
GCTTCCAGGGCCGCGGCACCCGCGCCCGTGGCCGCTCCCACGCCGACGCCCGGCGCCTCG
CTGCGCGCCGAGATCGTCGAGCTGGTCCGGCAGGTCGCGGCCGACCCGGACCTGCTGGAG
GTGGAGGGTGACCGCGGCTTCTACGACCTCGGTCTGGAGTCGACGGACCTGCTCGCCCTG
GTGCGCTCCTTCGAGGAGCGGTGGAACATCACGCTGTACCCGACGCTGCTGTTCGAGTAC
CCCACCGTCGACGCGGTCACGGAGCACCTGGCCGGCCTGATCCCGGACCGGCCGCGCGCC
GAGGCGCCGCCGCCCGACGACACCCCGGCCACCACCGCCTGCCTCACCGGCACATGGCAG
CCGGCGGCCCGGCCGGACCCGCCGTCGATCGGGTCCCTGCTGGTCATCGGCGACGCCCGG
TTGCGGCCGGATCAGATCACCGCACGGCGCGGCCCCGCCTTCCGGCGGCTGGGGGAGCGG
GAGTACGAGCTGCGTCCCAGCGCACCGGACGACCTGCGAGCCCTGCTGGCCGACCTGCCC
GGCGCCCCCGACTCGGTCGTGCACCTCGCCCCGCGCGCCGACGCCGACCCAGCGGAGGGC
GTGGAGACCGCGTGCCGGGAGATGCTGGCGCTCGCCCGGGTACTGCTGGACGCCCCGGTG
CCGGTGGTGCACGTCGCTCAGCCGCTGGTCGCCGCCGCGGTGGCCGGAATGGCCCGCACC
ATCCGTCTGGAGCAGCCGCGGCTGGCCGTGACCGCGGTGGAATGCGTGGGCGACCCCGAT
CCCCGGGCCGTTCTCGCCGAACTGTCCGGCCACGGCGAGACCTGGGTCCGGCACGACGGC
GGCCGGCTCGTGCGTCGCTACCGCGACGCGGCGCCCGGCGGAGCACGGCCGCTCCGGTCC
GGCGGTGTCTATCTGATCACCGGTGGCGCGGGCGGCCTGGGTCGGGCGCTCGCCGCGTCC
TTCACCGCACAGGGCGCCACGGTGGTACTCGCCGGGCGCACCCCGTCCAAGCAGGTGCCG
AACGCCGAGTTCGTACGCGCCGACGTGACCATGGCCGCCGACGTGCGGGCCCTGGTCGAC
GGGGTCGTCGCCCGGCACGGCCGCCTCGACGGGGTGGTGCACGCCGCCGGGGTCCTCAGG
GACGGCCTGCTGGCCGGAAAGTCACCGGAGGACCTGTCGGCGGTGCTGGCGCCCAAGGTG
CGCGGCACCTTGCTGCTGCACGACGCGACCCGCCATCTCGGCCTGGACTTCTTCGTCGCC
TTCTCGTCGGTGACCGGTGTCGCGGGCAACGTCGGGCAGGCGGACTACGCCGCGGCGAAC
GCCTTCGTCGACGCGTGCGCACGTGAGTACGGGTTCACCTCCGTCGCCTGGCCGCTCTGG
GCGGACGGGGGCATGCGCACCGACGCGGCGACCGAGGCGGTGTTCCGGCGGCAGGGACAG
GTTCCGCTTCCGACCGGCGCGGGCCTCGCGGTGTTCGACGCGATCCGGGACCAGCGGGGC
GGTGAGGTCGTCGTGCTGCACGGACGCCCCGACCGTGCCCGCCGGGCTCTGGAGCTGCGC
GAGCCGGAGACCGGTTCCGTTGCCACGGAACCGGAACCATCCGTGGCAACGGAACCGGAA
CCGTCCCTGACCGCAGTCCGCGACGCCGCCGCGACGACCGTTCGGGAACCTCTCGCGGCG
ACCGCGGGCGATCCGCGGCCCTCCGGCCGGGACATCGCCGTGATCGGTGTGGCGGGCCGG
TATCCGATGGCTCCCGACCTGGACCGGTTCTGGGCGAACCTGCTCGACGGACGCGACTGC
GTCACCGAGATCCCGGAACAGCGCTGGCGGCCGGCCGGCTTCTTCGAGCCGGAGCGGGCC
GCCGGGCGCTCGTACAGCAAATGGGGCGCCTTCCTGGACGGGATCGACGAGTTCGACCCC
GCGTTCTTCCGGATCACCCCACGCGAGGCCGAGGGCATGGACCCGCAGGAACGGCTGTTC
CTCCAGACCGCGTGGCACGCGTTGGAGGACGCGGGCATCCCCCGCGCCGCGGTCGCCGGC
CGGCCCGTGGGCGTGTTCGCCGGCGTCATGTTCACCCAATACCAGATGCTCGGCCTCGGC
GCCGAGGAACGGCTGCCGGTGCTGCCGACGTCCTTCACCTCGGCGGTCGCGAACCGGGTC
TCCTACTTCCTCGACGCGCGCGGTCCCAGCCTCGCGCTGGACACCATGTGCTCGTCGTCG
CTGACAGCGCTGCACCTGGCCTGCGAGAGCCTGCGCTCCGGAGAGAGCGAACTGGCGCTG
GCCGGCGGCGTGAACCTGATCGTCCACCCGTACAAATATCTGCACCTGAGCCAGGTCGGG
TTCGTCTCGTCGGACGGGCGGTGCCGGGCCTTCGGCGCCGGCGGCGACGGGTACGTTCCA
GGTGAGGGCGTCGGTGTCGTCGTCCTCAAACCCCTGGCAGCCGCCGTGGCGGACGGCGAC
CGCGTGCTCGGGGTGATCAAAGGCAGCGCGGTCAACCACGGCGGGCGCGCCGGCGGCTTC
TACGTCCCGAACCCGACGGCGCAGGCGGACGTGATCCGGCAGGCGCTGGACCGCGCCGGC
GTGGACCCGGCCACGGTGAGCTACCTGGAGGCGCACGGCACCGGCACCGCCCTCGGTGAC
CCGGTGGAGATCTCCGCGCTGAGCCAGGTCTTCGCAGCCGGCGACACCCGGCTCGGCTCG
GTGAAGTCCGGCATCGGACACCTGGAGTCCGCGGCCGGCATCGCCGGGCTGACCAAGGTG
CTGCTGCAGCTGAGGCATCGCACTCTGGTGCCCTCGCTGCACGCGCGGCCGGCGAACGAG
GCGATCGACTGGGAGCGATCCCCGCTCAGCGTCCAGCAGGACGCCGGTCCGTGGCACACC
ACCGGCGACGTGCCCCGGCGGGCCGGCATCAGCGCGTTCGGCGCCGGGGGCAGCAACGCC
CACGTCGTCGTCGAGGAGTACTCGACACCGGCACCCGGCACCACGGACGGCCCGCAGGTG
GTGCTGCTGTCCGCCCGCACCCCGCGGGCCCTGCGCCTGCTCGCCGAGCGTTACGCCGAA
CTGCCCGCCGGGGACCAGGTGGCGGACCTGGCCGACGCGGCCGGGTTCCCCGACGCCGAC
CGGGACGCGCCCTTCGAGGAGTTGGGTCTGGACGCGGACGATCTGCGCCGGCTGATGCGG
GCCGTGGCCGCCCGAAGCCAAGGACAGCCGCCCCGGGTGGATGCCCAGTCGAGTCTGTCC
GCCCTGGCCGCGGCACTGGACGGCGCAGTCCCGCTGGCGGACATCGCCCACACCACGCAG
GCCGGGCGCGATGCGATGGCCGAGCGGCTGGCCGTGGTGGCCACCGACGTCGAGGAACTC
CGCACGGCTCTGCGGGGCTTCCTGAACGGTGACGAGTCGCGCGTCCACCGCGGACGCGCC
ACGGAGCCGGTCGACACGCCCGCGTCGGCCGACCCGGACACACTGGCCGCGGCCTGGGTG
AAGGGCGCCGCCCCGGACTGGGGCGTGCTGCACCGCGAGCGGCGGCCCCGCAAGACCTCC
CTGCCCGGCTACCCGTTCGAGCGGGTGCGCTGCTGGGTCGGGACGGGCACCGACGCAACC
GGCGCCACCGGCCGCGGCACCGCTGATGCGCCCGCCGCGGCGGCGCCACGCCCGGCGCAG
GTGTCGCTGGGCGCCGACGTTCCGCGGTGGGAGCCCTGTCCCGCCCCCGAGCCGGTGACG
CCGGACGGCCCGGTCGTGGTGCTCTACGCACCGGAACGCACGGGACTGGCCGCCGAACTG
GCCGCCCGGCATCCCGGCGCGCAGCGCGTCGAGATCGGTGGCCCGGTGACCGTGGACCCG
CGGGTGGTCTACCTGCTCACCGGCCCGGCGCCCACGGACGGTTGCGAAGCCTCGCGGGTC
GCCGGCGGGGAAGCGGCCGGAGTCCGGGCGCTGGCCGGGTACGCCCGCCGCTGGGCACGG
CTGCCCGAGATCGACTGGATCGTGGTCACCGCAGGGGCGGCCGCCGCGCCCGGACGGCGG
CTCACCGACCCGTACGCGGCCGGGGTACACGGCTTCGCCCGGGTGCTGGAGAACGAGCAC
CGCGGGTGGTCGGTCGCCGTCGTCGACCTCGACCCGGCCCACCTGACCGCTGACGTGCTG
GTACCGGCGCGGCGCGGAACGCGGATCGCCTGCACCGGGACGACCGCGCACCGGCAGGTG
CTGGGCGAGGCGCCCGCGCCGCACGGCCCCGAGCTGCTGCGCCGGGGCGGCCGCTACCTG
ATCGTCGGTGGCGGCGGCGGTATCGGCCTGGCCCTGGCGCGCAAGCTGGTGGTGGAGTGG
GACGCGGAGGTCGTGCTGGTCGGCCGCCGGGAGCGTCCCGACCTCGCGGCCGAGCACCGG
ATCCGCTACCTGCGCGCCGACGCCTCCGACGCGGGGCAGCTCACCGCGGTACTCGAACAG
GCCGGCCCGGTGCACGGGATCATGCACGCGGCGATGGCGCAACGCTCCCGCCTGGTGCGC
GACCTCTCCGACGACGACCTCGCCGAGAGCCTGACGGCCAAGTCCGGTGTCGCCGCCGCC
CTGGTGGACACCATCGACGCGACGGATCTCGACTTCCTCCTCTTCTTCTCCTCCGCCCAG
TCCTTCCTCGGCGAGCCCGGCCTGGCCGGCTACGCGGCCGGATCGACCTTCCTCGACGCC
TATGCGCACACCCTCGACGAACGCCTGCCGTACCCGGTCCGGGCCGTCGACTGGGGTTTC
TGGGGCACGGTCGGCTCGGTCGCCACCGAGAAGCACCGCGCCGAACTGACCGCCGCCGGA
TTCCACTCCATCACCCCCGACACCGGCCTCACCGCGCTGACCGAGGCGCTGCGCCGGCCG
GCTCCGCAGCTCCTGGTGGTGCCCGGCACGGCCGCCCTGCGGGAGCGGATGACCCCCAGC
GAAGGGACGACACCGGCCGTGACACCTGCCGAGGGGCTGTTGACCAGCGCCGACCTGCGC
GTCGTCGACGACTTCCACGCCGTCGACGAGAAGATGTCCGCCATCGCCCGCGGCGCCCTG
CTGGCCGTGCTGCACGAGATGGGCGCCTGGCAGGGACCCGACCCGGACGCGGCCGAGGTC
GCCCGCAGGGTGGGGGTCACCCCCCGCTACGACCGCCTGCTGCACACCCTGCTGACCATG
CTCGCCGACGACGGGGTGCTCACCGTCCACCAGAACAGGTTCCGGCCGGATCGGGCCGCG
CTCGCCGAGGCCCTCGCCGGCGGGCACGCCGAGCGCCTCGGCGAACTGGCCGCGGCCCAT
CCGGCGTCCGCGGTCTTCGTCGAGCTGCTACGCCGCTGCCTCGACCGCTACCCGATGCTG
CTCCGCGGCGAGTTGCTCGCCACCGACCTGCTGTTCCCCGCCTCGGGCACCTCCGCGATG
GAGCGGATCTACCGGGACAACCCGATCAGCGACCTCTACAACGACGTGCTCACCGCGAGG
CTGCTGGAGCACGTCGGCCGGCGCCGGGACCGGCTGCGCCCCGGCGAGCGGATCCGGATC
GTCGAGGTCGGCTCGGGCACCGGCGGCACCACCGCTGGTCTGCTGCGTGCCCTGGCTCCC
CACGGCGAGCACCTGGAGTACTGGTACACCGACCTGTCGGCGGCGTTCCTGGCCCACGGC
CGCCGGGAATTCGGCGCGCGCTACCCCTTCGTGCGGTTCAAGCGCCTGGACCTCGACACC
GACCCGGTCACCCAGGGCTTCCCCGCGGACGCCTTCGACATCGCTGTCGGCGCGAACGTG
CTGCACGCCACCTCGGACGTGAGCCGCGCCGTGCGGCACCTGCGCACCGTGCTGCGCACC
GGCGGGCGACTGTTGCTCAACGAGCTGACCACGGTCACCCTGGCCGCCACCGTCACGTAC
GGACTGTTCGACGGCTGGTGGGCACACACCGACGCACACCTGCGGCTGCCCGGATCGCCG
CTGCTGGACGTGGCCGGCTGGAGCGCGGTGCTGACCGGCGCCGGCTACGACGGGTTCCGG
GCCCTGCCCACGGACGGTGAGACCAGCCGCAACTTCCAGCACGTCGTCGTGGCCACCGCC
GCGGCACGAGCCACCGAACCGGCGCCGGGGACGGCGTCCGGGCGGGTCGCGGCACAGCGG
GCCCCGGAGGACGACGGCGCCTCGTTCACCGCCGAGCTGCTGGCACTGACCTCGGAGGCA
TCAGGCATCCCCGTCGAGGATCTTGACCTGGACACCGAGATCGGTGACTACGGCTTCGAC
TCGGTCAGCTACGGTCTGCTCGCCGGGCGGCTCAACGACACCTTCGGTCTCGACGTGACG
CCTGCCCTGTTCTACGAGACCGCCACCCTGCGCGCACTGGTCGCGCGGCTCGACCGCGAC
TACGGCGCCACCCTGCGGGAACGGTATGCACGGACCGTACCGGAGGCGACGGAAGCCGAG
GCGCCGCCGCGCTCCGCGCCGCAGACCGGACCCGACGACCCGATCGCGGTGATCGGGATG
GCTGCGCGGCTGCCCGGCAGCCGAGACCTGGACGACTTCTGGAACCACCTGGTCGCCGGG
GACGACCTGGTCACCGACGTGCCCGCGGACCGGTGGGACTGGCGGTCCCTGCCCCCCGAC
GTCCTGGCCCGGCGCGGCGGCTTCATCAGCGACGTCGACATGTTCGATCCGCTGTTCTTC
GGGATCTCGCCGCAGGAAGCCGCCGGTATGGACCCTCAGCAGCGGCTGCTGCTGGAGGGC
GTGTGGACCGCGCTGGAGGACGCCGGCCTGCCGCCCGGCACACTCGCCGGCTGGCCGGTC
GGGCTGTTCGTCGGCGCGGGGTCCAGCGACTACGACGAGATCCGGCGCCGCTCGGACGTG
CCCGTCGACGCGCACGCGGCCACCGCGACCGCGCACTCCATCCTGGTCAACCGGGTGTCC
TACCTGCTGGACCTGCGCGGGCCGAGCGAGCCGGTCAACACCGGCTGCTCCAGCTCCCTG
GTCGCGATCCACCGCGCCGCCGCCGCGATCCGCTCCGGGGAGTGCGACATCGCGGTCGCC
GGAGGCATCAACCTGATCCTGTCCCCGCACAACCACCTGCTGCTCAGCCGCACCGGCATG
CTCAGCCCGTCCGGGCGGTGCCGGGCGTTCGACGCCCGCGCGGACGGGTTCGTCCGGGGA
GAAGGGCTGGGCCTGGTCGTGCTGACCCGGTTCGGCGCGGCGGGTCGGCACCGGGTACGG
GGGCTGCTGCGCGGCTCCGCGGTCAACCACGGCGGCCGGGCCCGTTCGCTGACCGCGCCC
AACCCCGCCGGACAGGCCGCGATGATCGTACGCGCCCACACGGAGGCCGGCGTCGACCCG
GCGACCGTGGGATACCTGGAGACCCACGGCACGGGCACCGAGCTGGGCGACCCGGTCGAG
ATCAACGGGTTGCGGCTGGCCTTCGAGGAGCTGGCGGGCCGCCACGCCGGGCTGCCCGGC
GCGCCGTTCTGCGGCCTGGGCGCGGTCAAGGCGAACATCGGGCACCTGGAGTCCGCCGCG
GGCATCGCCGGGTTGCTCAAGGTCCTGCTGGCGATGCGCCACGGCATCCTGCCGCCGGTG
GCCGGGCTGGGCGAGCCCAACCCGCACCTGCGGCTCGAGGGCAGCCCGTTCCAGCTGATC
CGGCGGGCGACCCCCTGGCACCGCCCGCCGGGCGGCGGCAGGCGCCGCGCCGGGATCAGC
TCCTTCGGCTACGGAGGAGTGAACGCCCATGTCGTGGTGGAGGAGCCGGCCGAGCCGGCG
GTCCCGGCGGCGCCGGCCGGTCCGCTGGTGTTCCCGCTCTCGGCCCGGACCCCCGAGGCC
TTGCGCCGCTACGCGACCGCGCTGCGTGCCGCCCTGGACTCGGACGTCGAACTGGTGGAC
GTGGCCCACACGCTGCAGCACGGCCGGGACGCGATGTCCGAGCGGCTGGCGGTGACCGCC
GTCGACCGGCCGACGCTCCTCGCGGCCCTCGGCGCGGCGATCGACGGCACCGGACACCCC
GCACTGGCCCACCCCGGGGGCGTCACACCGGCCGACCGGTGGGTGGCCGGAGCAGAGGCT
GCCTGGCCGGACACCGGTGGCACGCTGATCCCGCTGCCCACCTACCCGTTCGAGCGACGC
CGGTGCTGGATCGGCGCGCGGCCGCAGGAGCCCGACGCACCCGGCGCGCCCGTGGGCGTC
TACGCTCCGCGCTGGCAGCGCATCGCGGACGCCGGCACCCGCCCGTCGGCCGACGGACCG
GTCTGGCTGCTCGGCGGCGACGACTACCCGGCGAGCGACGTGCACCGGGTCACCTCCACG
TCGCTGGACGCGTTGCCCACGCCCACCGTCGTGCACGCGGTCGTCACCGGCGGCGAGCCC
GCGGTCCGGGAGCTGTTCCGGGTGATCCGGCACCTGCAGACCCGGCCGGCCGGTGCGGGC
GAGCTCACGCTGACCGTGGTCACCCGCGCCGCCGCGGCGGTGGACGGGCCGATCACGGAC
CCCGTCGCGGCGGCCGCCCACGGACTGGTGAAGTCGGCCCGCCGGGAGTGCGAGAGGTGG
CGGATCAGCGCGATCGACGTCGGCCCCGGCGACGACACCACGGTCGCCGCCGCCACGCCC
GGCGACTACGCGCTGCGCTCGGGTCGCTGGCACCAGCGGGTGCTCCGGCCGCTCGACGAC
ACCGGCGCCCGGCCGGTGTTCCGCGACGGCGGGACGTACGTGCTGGTCGGCGGCGCCGGG
GATGTCGGCCTCGACCTGGCCGAGCACCTGGTCCGGGAACACCGCGCGAAGGTGGTGCTG
ATCGGCCGGACCCGCCCGGACGGCGCCCGGGCCGACCGGATCGCCTCTTTCGACCCCGCC
GGCACGTCCGTGGAGTTCCACCAGGCGGACGCGCGCGACGCGGAACGGCTGCGGGCGGTG
TTCGACCGGGTCGGCGTGATCCACGGCGTGGTCAACGCGGCGACGGTGGCGCGAGACCGG
TCGCTGGCGGCGCTGGACGAGGACTGGTTCGCCGAGGGGCTGAACGCGAAGACCCGGACC
ACGCTCGCGGTCGCCGAGGCGATCGGCGGCCGCGACCTGGACTTCTTCGCGGTCTTCTCC
TCGCTGCAGTCGTTCCTGGGCAATCCGGGCCAGGCCGCCTACGCCGCCGCCTGCACCGCC
CAGGACGCGATCGGGCAGGCACTCGCCGCCCGGTCGCCGTTCCCCGTCCGCGTACTGAAC
TGGGGGCCGTGGTCGGGCTCGGCGCTCACCGAGCGCCACCGGGACCGTCTGGCCGCGGCC
GGTCTTCATCCGCTCCCGCCCCGCACGGGCATCGAGGCACTGGCCGGCGTGCTCGGCCGA
CAGGAGGTTCAGGTGGCGGTCGTGTCGGGTACCGAGCAGGCCCTGGCCGGAATCGGCGTG
CCGACGCCCGACCCGGAACCGGCCCCGCCGGCAGTCACGTCGGCCGTTGTGCAGCCTGTC
GCGCAGCCCGTCCCGCCGAGTGCCGAACCGTGGCGTGCGGCGGTGGCCGCCGACCTGCTG
GCTCTGGTGCGCGGCGTGGCCGGGCTGGGCGCCGCCGAGCTGACCGAGAACGACCAGCTC
AGCCGGTTCGGCTTCGACTCCATCATGTACACCAGGCTCAGCCACCAGGTGAACGTGCGC
TGGGACCTGGACGCGACTCCGGCGGCGTTCTTCGGCGTGGCAACCGCCGGCGAACTGGTC
GCGAAGATCACCGCGGAGTACGGGGAAGAGCTGGCCCGTCACTATCGTCCCGCGGCATCC
ACCGCTCCGGCCGTCCCTCCGGCCACGGCCGTTCCGCCCGGGCCCGTCGCTTCCCCCGGG
CCGATCGCGGGCACCGGAGCCGCCGGGGTGGCGCAGCCCGCCGGTACGGACGACGTCGCC
ATCGTCGGCATGGCCGGTCTGCTGCCCGGCTCGGACGACCTGGACGAGTTCTGGGCCCAC
CTGGCCGCCGGCGACGACCTGGTCACCGAGATCCCGGCGGACCGGTGGGACTGGCGACGC
ATCCACGGCGACCCCGAGCCGGGGGAATTCCGCACCACCGCCCGCTGGGGCGGGTTCCTG
CGCCGAGTGGACCTGTTCGACGCGGACTTCTTCGGCATCTCGCCCACCGAGGCGGTCGCG
ATGGACCCGCAGCACCGGCTGGTGCTCGAAACGACCTGGACGGCGATCGAGGACGCCGGC
ATCCGGCCCTCCGACCTGGCCGGCACCGACACCGGCGTCTTCGTCGGCAGCAGCACCTAC
GACTACTTCGAACTGCAACACGCGCTGGGGGTGCCGCTCGACGGCTACAACACCGTCGGC
CGGGCGCACGCCATCCTGTCCAACCGCGTGTCCTACCTGCTGGACCTGCACGGCCCGTCC
GAGACGCTCGACACCGCCTGCTCGTCGTCGCTGGTCGCCGTGCACCACGCGGCGGAGGCG
ATCCGGCGCGGGGAGTGCACGGTGGCGCTGGCCGGCGGCGTCAACGTGATCGCGTCGCCG
ACGCTGTTCGTCGACATGAGCCAGGCCGACATGCTCAGCCCGGACGGCCGCTGCCGCGCC
TTCGACGCCCGCGCCAACGGCATCGCCCGGGCCGAGGGGGCGGGTGTCGTGGTGCTCAAG
CGGCTCAGCGCGGCCCTCGTGGACGGAGACGTCATCCACGGCGTGCTGCGCGGCAGCGCC
GTCAACCACGGTGGGCGCGGCAACTCGCTCACCGCGCCGAACCCGGCCGCGCAGGCCGAC
TGCATCGTGGCAGCGCACCGCCGCGCCGGGACCGAACCGCGCACGGTGACCTACGTGGAG
ACCCACGGCACCGGCACCGAGCTGGGCGATCCGGTCGAGATCGAAGGCCTCAAGACCGCC
TTCCGGCGGCTGTACGCCGATCACGGCACCGACGGCACCGATCACCGTGTCGCGCTCGGC
GCGGTGAAGAGCAACACCGGTCACCTGGAGGCGGCCGCCGGTGTGACGGGGCTGATCAAG
GTGCTGCTCGCCATGCGCCACCGTGAGCTGCCCGGCAACCCTCACCTGGAGAAGCTCAAC
CCGCACCTGCGTCTCGACGGCAGCCCGCTGCATGTGCTGCGCGACCGTGAGCCGTGGCGG
CGCGTCACCGGCCCGGACGGCACCGAGGCGCCGCTGCGTGCCGGACTGAGCTCGTTCGGT
CTCGGCGGTGTCAACGCGCACCTCGTGCTGGAGGAGTTCCGCACCCGGCCGAGCGCCGGT
CGTAGCGGGCCGTACCTGTTCGTGCTGTCCGCCCGCGACGCCGAGCGGCTGCGTGGCAAC
GCCGAGCACCTGGTCCGCTGGGCACGGGACGCCGACGAGGTGGACCCGGCCGCCCTCGCC
TACACGCTGCAGACCGGCCGGGAGGTCTTCGCCGAGCGGCTCGCCGTGGTCGCGGACGAC
CTCGCCGGCCTGGTGAAACGCCTGGAGGAGTGGCTGGCCGGCGCGACCGCCGACGGCGTC
AGTGCGGGCGACGGGCGAGGGACCGGCACGGCGCTGCTGCTGGACGGCCCCGAGGGACGC
CAGTACCTGCGCACGGTGGTGGCGGCCGGGAAGCTCGACAAGATCGCCCGGCTGTGGGTG
GACGGCGTCGACATCGACTGGGCCGAGCTGTGGCCGGGGGAGCCGATGCGCCGGGTACCG
GCGCCGACCTCCGCCTTCGCCCGGCAGAGCTACTGGATCACCCCCGGGCCACGGTTCGAC
CAGGCGCAGGCCGAGGCGGCCGGGCTCGCCGGGACCGCTCAGGACGAGGTCACCGAGACG
TGGCCCGAGCCCGCAGCGGCCGTACCGGCACCCCCGGCCGAGTCGGCGCCGGCACCGGCC
GCGACGGCCGCCGGAGGCGACCCGGAGTCAGCTGTGCGCGACCACGTCCGCACCCTGCTC
GCCGCGCACCTGGGCATGGCACCGGACCGTCTGCCGCCCGACCGGGTGCTGTCCGACGTC
GGTGTGGACTCGCTGGGGCTGCGCCGCCTCAGCCGCCGTCTCGGCGCCACCTACGGCGTC
GACATACCCGCCCGCATGTTCGGCGTCGGGCAGACCGTGCGCGCTCTGGCCCGGGCCGTG
CACGACAAGTACGGACCGCTGCCCGCAACCGCCACACCCGAGCCGCCCCCCGCGCCGGTC
ACCTCCTCGGCCACCGCACCCGAGCCAACCTCTGTGCCGGTCGCCTCCTCTGCCGCCGCG
CCCGCGCCGATCCCCGCGCCGGTCGCCCCTTCGGCCGCCGCGCCCGCGCCGGTCGCCTCC
TCGGCCGCCGCGCCCGAGCCGCCCCCCGCGCCGGTCGCCGCCGACGCGGTCGGTGCCCTG
CTGGCCGGGCTGCGCGACGGATCGGTCACGGTCGACGACGCGCTGGCCGAGCTGCGACAG
GGGAACGTCCGATGA
[2] DH16..155
[2] ACP301..371
[2] KR582..743
[3] KS850..1215
[3] KR1697..1864
[3] MT2121..2224
[3] ACP2329..2398
[4] KS2433..2802
[4] KR3171..3347
[4] ACP3435..3504
[5] KS3557..3936
[5] ACP4212..4281
[2] DH46..465
[2] ACP901..1113
[2] KR1744..2229
[3] KS2548..3645
[3] KR5089..5592
[3] MT6361..6672
[3] ACP6985..7194
[4] KS7297..8406
[4] KR9511..10041
[4] ACP10303..10512
[5] KS10669..11808
[5] ACP12634..12843

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [329-344]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [301-371]  PS50075 [2329-2398]  PS50075 [3435-3504]  PS50075 [4212-4281]  PS50075
PS50075   ACP_DOMAIN
 [304-370]  1.3e-07 PF00550 [2332-2397]  1.1e-10 PF00550 [3438-3502]  3e-06 PF00550 [4216-4280]  8.59999999999999e-08 PF00550
PF00550   PP-binding
 [297-388]  4.30000170645867e-14 SSF47336 [2322-2449]  2.10000267834031e-17 SSF47336 [3428-3573]  6.80000200614766e-12 SSF47336 [4205-4302]  2.89999717862184e-16 SSF47336
SSF47336   ACP_like
 [301-375]  2.99999999999998e-49 G3DSA:1.10.1200.10 [2330-2400]  2.8e-48 G3DSA:1.10.1200.10 [3434-3509]  2.8e-48 G3DSA:1.10.1200.10 [4210-4284]  2.99999999999998e-49 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013217 Methyltransferase type 12 (Domain)
 [2121-2224]  5.69999999999999e-14 PF08242
PF08242   Methyltransf_12
IPR013968 Polyketide synthase, KR (Domain)
 [582-742]  1.5e-44 PF08659 [1697-1862]  1.5e-34 PF08659 [3171-3346]  2.99999999999998e-40 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [850-1095]  7.79999999999999e-88 PF00109 [2433-2670]  2.30000000000004e-80 PF00109 [3557-3805]  1.5e-87 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1103-1215]  1.70000000000001e-39 PF02801 [2683-2802]  1.80000000000002e-35 PF02801 [3814-3936]  7.10000000000008e-39 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [850-1106]  G3DSA:3.40.47.10 [1107-1268]  G3DSA:3.40.47.10 [2433-2678]  G3DSA:3.40.47.10 [2684-2857]  G3DSA:3.40.47.10 [3557-3815]  G3DSA:3.40.47.10 [3817-3994]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [842-1269]  3.49999466863949e-95 SSF53901 [2425-2858]  1.69998802370953e-85 SSF53901 [3549-3933]  1.09999184471405e-88 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [580-745]  9.49999999999983e-89 G3DSA:3.40.50.720 [1695-1869]  8.19999999999987e-90 G3DSA:3.40.50.720 [3170-3353]  1.39999999999997e-95 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [2587-2603]  PS00606 [3718-3734]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [299-374]  3.50000235434314e-09 SM00823 [2330-2401]  4.70000326671386e-10 SM00823 [3436-3507]  2.79999889404114e-05 SM00823 [4213-4284]  4.70000326671386e-12 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [852-1269]  SM00825 [2435-2858]  SM00825 [3559-3995]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [582-743]  5.59999989417026e-40 SM00822 [1697-1864]  4.00000300869883e-21 SM00822 [3171-3347]  7.0999832511256e-34 SM00822
SM00822   PKS_KR
SignalP
 [1-5]  0.487 Signal
Bacteria, Gram-positive   
TMHMM No significant hit