close all open/close all

CDS information : Kirro_00240


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction44,173 / 48,825 / + [in whole cluster]
44,173 / 48,825 / + [in contig]
Location44173..48825 [in whole cluster]
44173..48825 [in contig]
TypeCDS
Length4,653 bp (1,550 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.3 PKS/NRPS hybrid
Productnon-ribosomal peptide synthetase/polyketide synthase
Product (GenBank)putative hybrid non-ribosomal peptide synthetase/polyketide synthase
Gene
Gene (GenBank)kirAIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

6 glycine
7
C37..336
A521..900
PCP998..1067
KS1126..1491

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [putative hybrid non-ribosomal peptide synthetase/polyketide synthase]
MSRALRDVLAAVAAGELPDEIAESLLRGLSDPVPEPGPYPLSRGQAALWAIHASRPGTTS
YNLPLGLWLNQAVDPDVLTRALIAVVERQPGLRIAVRLDGTTPVQEITERPAEVVRLDLR
HVTDGEFAARIRRLVHTPFDLEQDPLHRMWLIAAPGGRTLLLLVFHHMITDGISSHLLLR
DIVACHDALARRGVLPPVEQATPYREFVRRQRELLDGPEAETHRRWWLDRLAGASSGPVL
DAITDRHRVAPPTADTGAMVQFRLPEETWTAVRHVAGAAGLTPFSVLLGAFAALLHRHSG
HRDINVMVPTDGRISERFDRTVGYLINPVVVRVDCDPQRSLAELMNAVHDHMAQAEEHSS
YPFAAVVGDLRRAGGTAVSFDIGFYLQQGVGGDQDMAAGQTVFDDALELTQEGENPLVVE
VVVRGSQALVHFKYDRELFDPATAERLAEHYRMLLETVAADPRRPIGDLPLTTAAERALV
DRANDTRAARPRDVTAAGLVLARAASAPERVAVVDADGATSYGELARRVHALARTLRASG
VGRGDLVGVLSGRRAALIVAMLAAHTAGAAYVPLDPDFPAARLAHICTDAGLAAVLVDPA
YCDRLPAETPGARIPLGDPGDAAPGPPVACHDDDLAYVLYTSGSTGRPKGVEVTHGNLVN
FLTAMAERPGCAEDDVLLAVTTAGFDIAGLELLLPLTQGATVHIAPAETTRDGFALAGLL
DSSGATVVQATPATWQMLLAAGWSGRVPRLLCGGEALSAELAAELIDRSGELWNMYGPTE
TTIWSSVLRVRRDRPITVGTPIANTTFHLAGPDGGPVPFGATGELLIGGDGVARGYRGRP
ELSAERFVGQDGQRRYRTGDLARWTETGEMLLLGRADRQIKLRGHRIEPGEIEAAIRRTG
VSGEARVVLREERPGHQRLVAFVVAEPAEAAAAARRIEEWLPAYMIPSRTVPMTGLPMTP
NAKIDAVRLATGSLDELIREFGHPEAAPEPRPHDGGRLLATLRELTAGVAGVAPEDIPVD
RPLGEAGFDSVGFTRLAMAVRTRFGVPVSPTLFYAHPALASLAAHLGANRPDAFTEAEAV
PDAFTETEAVPDTFAETEAEPEPARAAATVRAGAPGEPPETLGYPPVAIIGVGARLPASG
SLQEFWIHLAEGRDLTAPYPLERGFSARVFPERFRGSFVRDVDAFDAGRFRISPREAAQM
DPQHRLLLHAADEALLDAGLVPATLVGSHTGVFVGLSGADYLSLLGPGSPEMDDHFLIGN
VASIAANRISYVYDLHGPSAVYDTACSSSLVAIHRAARALHLGDCDLALAGGANLLLSPH
GFTGLRRAGMLSADGRCKTFDERADGYGRGEGVVLLALKLLERAVADGDPVHGVLIGSAE
NHGGHTHSLTVPNPQAQRDVLLAAHRAAAVPPDTIGYIEAHGTGTPLGDPIEVDALREAF
GQLYRDWGRPVVEGRTGLGSVKSNIGHLEAAAGVAGVVKVLLSMRHRLMPGLAGLGTPNP
MIDLAGSPFRLQAEAQPWEPPDGVPARAGVSSFGMGGSNVHVVVAEAEKH
selected fasta
>non-ribosomal peptide synthetase/polyketide synthase [putative hybrid non-ribosomal peptide synthetase/polyketide synthase]
ATGAGCCGGGCACTGCGCGACGTCCTCGCCGCGGTCGCCGCCGGTGAGCTGCCCGACGAG
ATCGCCGAGTCGCTGCTGCGGGGCCTGTCCGATCCGGTGCCGGAGCCGGGGCCGTATCCG
CTCAGTCGCGGCCAGGCGGCGCTCTGGGCGATCCACGCGAGCCGACCCGGCACCACCTCC
TACAACCTGCCGCTCGGGCTGTGGCTGAACCAGGCGGTCGATCCGGACGTGCTCACCCGG
GCCCTGATCGCCGTCGTGGAGCGGCAGCCGGGTCTGCGGATCGCCGTCCGACTGGACGGG
ACCACTCCGGTGCAGGAGATCACCGAACGCCCCGCCGAGGTGGTCCGGCTGGACCTCCGG
CACGTCACCGACGGGGAGTTCGCCGCGCGCATCCGGCGGCTGGTGCACACTCCGTTCGAC
CTGGAGCAGGACCCCCTGCACCGGATGTGGCTGATCGCGGCACCCGGTGGCCGGACCCTG
CTGCTCCTGGTGTTCCACCACATGATCACCGACGGGATCTCCAGCCACCTGCTGCTGCGC
GACATCGTGGCCTGCCACGACGCACTGGCCCGTCGAGGTGTTCTGCCGCCGGTCGAGCAG
GCCACCCCGTACCGCGAGTTCGTCCGTCGACAGCGGGAACTGCTCGACGGGCCGGAGGCC
GAGACGCACCGCCGCTGGTGGCTCGACCGGCTGGCCGGAGCCTCCAGCGGTCCCGTCCTC
GACGCGATCACCGATCGGCACCGGGTCGCCCCGCCCACCGCCGACACCGGCGCGATGGTG
CAGTTCCGGCTGCCGGAGGAGACCTGGACGGCTGTCCGTCACGTCGCCGGCGCGGCCGGT
CTGACCCCGTTCAGCGTGCTGCTGGGTGCCTTCGCCGCTCTGCTGCACCGGCACTCCGGC
CACCGCGACATCAACGTCATGGTGCCGACCGACGGCCGGATCTCCGAGCGTTTCGACCGC
ACCGTGGGCTACCTGATCAACCCGGTGGTCGTGCGGGTCGACTGCGACCCGCAGCGCAGC
CTCGCCGAGCTGATGAACGCCGTGCACGACCACATGGCGCAGGCCGAGGAACACAGCTCC
TACCCGTTCGCCGCCGTGGTCGGTGACCTGCGCCGCGCCGGCGGCACCGCGGTCTCCTTC
GACATCGGCTTCTACCTGCAACAGGGCGTGGGCGGCGATCAGGACATGGCCGCCGGGCAG
ACCGTCTTCGACGACGCCCTGGAGCTGACCCAGGAGGGTGAGAACCCGCTGGTCGTCGAG
GTGGTGGTGCGCGGGTCCCAGGCGTTGGTCCATTTCAAGTACGACCGCGAGCTGTTCGAC
CCGGCCACGGCCGAGCGCCTGGCCGAGCACTACCGGATGCTGCTGGAGACCGTGGCCGCC
GATCCCCGGCGGCCGATCGGCGATCTGCCCCTCACCACCGCGGCGGAACGCGCCCTCGTC
GACCGGGCCAACGACACCCGTGCCGCCCGGCCCCGCGACGTGACCGCGGCCGGTTTGGTG
CTGGCCCGCGCGGCGTCGGCCCCGGAGCGCGTCGCCGTGGTGGACGCCGACGGTGCCACC
AGTTACGGCGAGCTGGCCCGGCGGGTGCACGCACTGGCGCGGACCCTCCGCGCATCCGGC
GTGGGCCGTGGCGACCTGGTCGGGGTGCTGTCCGGCCGGCGAGCCGCCCTGATCGTGGCG
ATGCTGGCGGCGCACACCGCCGGCGCGGCCTACGTGCCGCTCGACCCGGACTTCCCGGCC
GCCCGCCTCGCGCACATCTGCACCGACGCCGGCCTCGCCGCGGTCCTGGTCGACCCGGCG
TACTGCGACCGCCTGCCGGCCGAGACACCGGGCGCCCGGATTCCGCTAGGTGACCCGGGC
GACGCCGCCCCGGGCCCGCCGGTCGCCTGCCACGACGACGATCTCGCGTACGTGCTCTAC
ACCTCCGGATCGACCGGCCGGCCCAAGGGTGTCGAGGTCACCCATGGCAACCTGGTCAAC
TTCCTCACCGCGATGGCGGAGCGGCCCGGGTGCGCCGAGGACGACGTGCTGCTCGCCGTC
ACCACGGCCGGGTTCGACATCGCAGGGCTCGAACTGCTGCTCCCGCTCACCCAGGGCGCG
ACCGTCCACATCGCGCCGGCCGAGACCACCCGGGACGGCTTCGCGCTGGCCGGCCTGCTC
GACAGCAGCGGCGCGACCGTCGTGCAGGCCACCCCGGCCACCTGGCAGATGCTGCTCGCC
GCCGGCTGGAGCGGACGGGTACCCCGGCTGCTGTGCGGCGGGGAGGCGCTGAGCGCCGAG
CTGGCGGCCGAACTGATCGACCGCTCCGGTGAGTTGTGGAACATGTACGGCCCGACCGAG
ACCACGATCTGGTCCTCGGTACTGCGGGTACGCCGCGACCGGCCGATCACGGTCGGCACG
CCGATCGCGAACACGACCTTCCACCTCGCCGGGCCGGACGGTGGCCCGGTCCCGTTCGGC
GCCACCGGGGAACTGCTGATCGGCGGTGACGGCGTCGCCCGCGGCTACCGCGGCCGCCCC
GAACTGAGCGCCGAGCGCTTCGTCGGGCAGGACGGGCAGCGGCGCTACCGCACCGGAGAC
CTGGCCCGGTGGACCGAGACCGGCGAGATGCTGCTGCTCGGCCGCGCCGACCGGCAGATC
AAGCTGCGCGGGCACCGGATCGAGCCCGGCGAGATCGAGGCGGCGATCCGGCGTACCGGC
GTGAGCGGCGAGGCGCGGGTGGTCCTGCGCGAGGAGCGGCCCGGGCACCAGCGCCTGGTC
GCCTTCGTCGTCGCCGAGCCCGCGGAGGCCGCGGCGGCTGCCAGGCGGATCGAGGAGTGG
CTTCCGGCGTACATGATCCCGTCCCGGACCGTGCCGATGACCGGCCTGCCGATGACCCCG
AACGCCAAGATCGACGCGGTCCGGCTCGCCACCGGCTCCCTGGACGAACTGATCCGCGAG
TTCGGTCACCCCGAGGCAGCGCCGGAGCCCCGGCCGCACGACGGCGGCCGGTTGCTGGCG
ACCCTGCGGGAGCTGACCGCGGGTGTCGCCGGGGTGGCGCCGGAGGACATCCCGGTGGAC
CGGCCGCTCGGCGAGGCGGGCTTCGACTCGGTCGGTTTCACCCGGCTCGCGATGGCGGTC
CGCACCCGCTTCGGCGTGCCCGTCAGCCCCACGCTCTTCTACGCGCACCCCGCGCTCGCC
TCGCTCGCGGCGCACCTGGGCGCGAACCGCCCGGACGCCTTCACCGAGGCCGAAGCCGTC
CCGGACGCCTTCACCGAGACCGAAGCCGTCCCGGACACCTTCGCCGAGACCGAAGCCGAG
CCCGAGCCGGCCCGCGCGGCGGCCACCGTCCGGGCCGGCGCGCCCGGGGAACCTCCCGAG
ACCCTCGGCTACCCGCCCGTGGCGATCATCGGCGTCGGCGCCCGCCTGCCGGCCTCCGGG
TCACTGCAGGAGTTCTGGATCCACCTCGCCGAGGGCCGCGACCTCACCGCGCCGTACCCG
CTGGAGCGAGGCTTCTCCGCCCGGGTGTTCCCGGAGCGCTTTCGGGGCTCGTTCGTGCGC
GACGTCGACGCCTTCGACGCGGGGCGGTTCCGGATCTCGCCGCGCGAGGCGGCCCAGATG
GATCCGCAGCACCGGCTCCTCCTGCACGCCGCGGACGAGGCCCTGCTCGACGCCGGACTC
GTGCCCGCGACGCTGGTCGGCAGCCACACCGGGGTGTTCGTCGGTCTCAGCGGCGCCGAC
TATCTGAGCCTGCTGGGCCCGGGCTCGCCGGAGATGGACGATCACTTCCTGATCGGCAAC
GTCGCCTCGATCGCGGCCAACCGCATCTCCTACGTGTACGACCTGCACGGCCCCAGCGCG
GTCTACGACACCGCCTGCTCCAGCTCCCTGGTGGCGATCCACCGCGCGGCCCGCGCCCTG
CACCTCGGCGACTGCGATCTCGCCCTGGCCGGCGGCGCGAACCTGCTCCTGTCCCCGCAC
GGCTTCACCGGTCTGCGCCGCGCCGGAATGCTCAGTGCCGACGGGCGGTGCAAGACCTTC
GACGAGCGCGCCGACGGCTACGGCCGCGGCGAGGGCGTGGTCCTGCTGGCGCTCAAACTG
CTGGAGCGCGCGGTCGCCGACGGCGACCCGGTGCACGGCGTCCTGATCGGTTCGGCCGAG
AACCACGGCGGCCACACCCACTCGCTCACCGTGCCCAACCCGCAGGCACAGCGCGACGTG
CTGCTCGCGGCGCATCGGGCGGCGGCGGTGCCGCCCGACACCATCGGCTACATCGAGGCG
CACGGCACCGGGACGCCGCTCGGCGACCCGATCGAGGTGGACGCGCTGCGGGAGGCGTTC
GGGCAGCTCTACCGCGACTGGGGGCGGCCGGTCGTGGAGGGACGCACCGGGCTCGGCTCG
GTCAAGTCCAACATCGGCCATCTCGAGGCCGCCGCCGGTGTCGCCGGGGTGGTCAAGGTG
CTGCTGAGCATGCGGCACCGCCTGATGCCCGGCCTCGCCGGTCTCGGCACCCCCAACCCG
ATGATCGACCTGGCCGGCAGCCCGTTCCGGCTCCAGGCCGAGGCACAGCCCTGGGAGCCG
CCGGACGGCGTGCCGGCACGCGCCGGCGTCAGCTCCTTCGGCATGGGTGGCAGCAACGTA
CACGTCGTCGTGGCGGAAGCGGAGAAGCACTGA
[6] C37..336
[6] A521..900
[6] glycine686..784
[6] PCP998..1067
[7] KS1126..1491
[6] C109..1008
[6] A1561..2700
[6] glycine2056..2352
[6] PCP2992..3201
[7] KS3376..4473

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [521-898]  1.9e-104 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [37-336]  2.59999999999998e-52 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [1025-1040]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [991-1133]  1.29999924468179e-15 SSF47336
SSF47336   ACP_like
 [998-1067]  PS50075
PS50075   ACP_DOMAIN
 [1001-1066]  1.2e-11 PF00550
PF00550   PP-binding
 [998-1070]  2.5e-15 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [521-900]  1.60000000000002e-115 TIGR01733
TIGR01733   AA-adenyl-dom
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [1126-1363]  6.10000000000004e-74 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1373-1491]  1.2e-36 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [1126-1374]  6.29999999999997e-85 G3DSA:3.40.47.10 [1377-1548]  6.59999999999996e-55 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [1125-1491]  2.19999900980707e-77 SSF53901
SSF53901   Thiolase-like
IPR020845 AMP-binding, conserved site (Conserved_site)
 [638-649]  PS00455
PS00455   AMP_BINDING
SignalP No significant hit
TMHMM No significant hit