close all open/close all

CDS information : Kirro_00250


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction48,825 / 68,021 / + [in whole cluster]
48,825 / 68,021 / + [in contig]
Location48825..68021 [in whole cluster]
48825..68021 [in contig]
TypeCDS
Length19,197 bp (6,398 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)kirAIV
EC number
Keyword
Note
Note (GenBank)
  • trans-AT polyketide synthase architecture
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

7
8
9
10
11
12
DH139..292
KR565..738
ACP821..889
KS937..1304
DH1512..1668
KR2002..2183
MT2433..2536
ACP2648..2716
KS2778..3139
ACP3429..3498
KS3516..3891
KR4295..4477
ACP4562..4631
KS4698..5066
KR5492..5693
ACP5829..5898
KS5928..6296

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MGNSTEDRAARLVVLSAGGRDQLDRYRAELVGWLQAHPEAALDRIESTLRTGREELAERL
AVVVTGVAELTERLRDGTGVVTGTAGPATGEPVQAADLHEAARLWVTGTPVRWPEQASGR
SARLSLPQPQPVTRRYWIEPPAALTADPAERLLTGDEFFLRDHALGQVRVLPAVAALEFA
VDTAARAGHGRATGVDHVLWARPVLFTGEPVRVRLRFAPAADGVAYELRRLDDTPDGELC
STGTLRFGPTEPAPSLDLAAIRARLPRTTSADDCYAVFAALGGGYGPSLRGLRSMRSVPG
EALAEVAVPDAADLPFDDFTLHPSLLDAMLQAALWTAADPSAPRPRELPFSIDRVEILGP
LPEHGYAHAVATGTGHDIALADADGRIAVRLRGVVTRSVKDPADPVDTHLLAQRWQDAPV
RRGAPATGRKVILEAGEDGCLPDSGPLVVVRLGDDDPLPSLVRLFRTWAAQPNRQPLRVL
HVFRPSGAVTDARLLALDGMARSIANEHPDFRAAVITTDGADPRAVADAEAAADHEFRVR
YTAAGRQVARWEPIAPAPAPLTPEGTVLVTGGAGALGRHLVSHLGPSARYVLTGRSADAD
LTDLRATGLDVHYLPCDLGAPGAAERLVERVHQRFGPLRGVLHLAGVTRDSFLLRKTDED
IAAVLGPKVDGTLALDRATAADPLDFFVCFSSMSGAGSPGQADYAYANRFLDAFAAWRRG
SDRPGRSLSVLWSLWADGGIRMDADDTTQARIARRAGLRPLPTADALRAWDRALGHDGDH
VLVAHGELDRIRALLDAPAPEPAPAPEPAPRAATGSATAAAEEFLRGVLAEVLQYPQEEI
EADTAFEQYGIDSLLIMDLTRRLEDHFGSLPKTLFFEYQELRGLAGWFAEHHGGRLAELT
PAPAPVPVPVQAPVVVATPDAAPSGERPAPPSADAPEPVAIIGVAARFAESDTLDEFWAN
LRAGRDLITEIPADRWDWRDYDEATPADRAAEYSRWGSFLRGIDRFDPLFFGISPREAEI
IDPQERLFLQTAWHAMEDAGLTRADLRARRVGVYAGAMYGLYQLHEAADGRIGASSHASI
ANRVSYTLGVTGPSLGVDTMCSSSLTAIHLAVRDLRSGEAEMALAGGVNLHVHPYKYRFL
GQGTFTSSDGRCRSFGADGDGYVPGEGVGAVLLKPLSAAVRDGDHIHGVILGSSVNHGGR
TNGFTVPNPVAQSDLVERALAEAGCSAAALGYLEAHGTGTALGDPVEVRALARALGASGL
PRGSLPIGSVKSNIGHLESASGMAGLCKVLLQMRHGELVPSLHADPVNPNIDFASTPLRV
QTETAPWPRRDGLPRRAGISSFGAGGANAHLVVEEYVPGPAPAAAPGPWLFPLSARTPEG
LRALAERLADAVDNGLADRLADVAYTLQHGREAWADRMVVLASTADELAGRLRAGTGTGV
WTGSVRGRAASRAAAPAAADPAGLAAAWTSGATVAWPGTGRRLPLPGYPFEELRCWLTER
MWAPSPAGPATHPLLDEIVPADSVDGLTFRTAFAPAHPLIDGHRVGDLRLLPAAAVLEMA
RAAAAHAGYPVPVRLRDVRWLRPLVVTGTVASARTRLRRDGAGLAFTLLGDTGDQLAQGL
VEARADDVPEPVPVERIRAALPHRHDGADLYTDLAGAGLVYGPALRAVEWIASGTDEALA
SLRVPAEAARFADCALPPALIDGALHTFAVLRDRAGGPMVPFALAAAEVVGPLPEHVYAH
VRTVGPDRYDLTLTDPDGGVLVLLRDLCLRPAPAAGTSDAGPAVTAVTAGPAVTERPVDD
LMYLPRWSPVAAEPFTVPSTAPGSDTWLIRPSCAAPLAAALATRLGGSVTEIEPEHFVAP
AGRPGHVIVLSGPAQGRTDDPAALDLAQERGVLALFRAAKALQRSGAPVRLTVVTEDALS
TGTEPVRNPYAASLHGLALSLAQEQPRWRVAVVDRSSADPISPDVLDVPAGGPYALRAGV
LHRRSLVPAAPTTTREAIRHGGVYLILGGAGGLGLELTEWLVRGYRAKVVLVGRSELDAG
RRDRLRRLDPAGALVSYRRADATDPAALAEVVTAVRAEHGTLHGVVHATIVLRDQTVATM
TEDTFRAVLDAKTRTSVALHRALVAADGLDFVLFFSSAVALSGSAGQANYAAGSTFEDAF
AHHLDDVLAARSAVVNWGYWGTVGIVADDRHRERLARTGIHSITPAEGMAAVHDVLGRTD
RQVVVIKATAEVLAAAGVERPAGERSDDELAPSAAALPPVARLLTETDQARLDEVVLGWL
WELFRGEGVFRTVGERWSADELRRRLRIADGQSRLFAELLRVLTVAGFLRDDGSALIATD
RRAPTDPENELVVLCEGQPALNRIDRLLRPCMHQLFGVLRGTVRATEVMFPGGSTELVEG
AYRGSPVVDRANELVVAAVLDRVGRLGGPVTVVEVGAGTGGTTASLLPALAATGVELTYV
YTDISPAFLQHGRQRFAERYPMVRFQQLDISGDPLAQGFPPGGADVVVAANVLHATPDLP
HTLRAVALLLKSGGHLVLNEATSNVVTATLTFGLLDGWWLHRDTGLRLPGSPLLSGRGWR
AALDLAGFTRSRALPADEGLTQHVVVAESGPAGPAAVTAPTAQPAPPPAAEPAPEPRTGG
GGRLVEAARDYVKDAFVQVLEVPRDRLWLDETYENFGVDSLTVPRIADLLAERMGDLPPT
LLFEHPTIREVADHLVERYPDRVRALLPDQPRPAPAQATEPAPAQATEPAPAQVTEPAPA
QVTEPAGRPAKTAPAADTRIAVIGVAGRYPLADDVDAFWTNLRTGLDCIREVPAERWDPR
TEPGANGTPVSRWGGFLDRIDEFDPRFFQMSMHEAELTDPQERLFLQTAWHTLEDAGYPR
TRLRGSRVGVYVGVMYGHYQLFEDERGLAGGMGYASIANRVSYALDLHGPSLAVDTMCSS
SLTAIHLACEALAAGGVDYALAGGVNLTPHPRKYRQLAAGGFTGESGRCRSFAAGGDGMV
PGEGVGAVLLKPLAAAERDGDRILGVILGSAVNHGGKTGGYAVPSPGAQSEVVTSALRAA
GVEPADVSYVEAHGTGTALGDPAEVAGLARAFGDRPAGSIAIGSVKSSIGHLESAAGIAA
LTKVLLQMRAGELTPSLHAEQLNPAVDWANVPFRVQREAAPWTGPRPLRAGVSAFGAGGS
NAHLVVEQYRAEPRPGVVPMPAVFPFSGRDAQALRRIVERMLSRLRELGATGLRGEPGAT
GLAEIAAAAGLPVGAVDEPLDELGLDPATIMRLAGRETALHQGAVHSGSTLRQLAAAPPD
AADIDLGRLSYTLQIGREAMAHRLAVVAHRTDELIEQLDAFLAGRPAGWTGVVTTEPGDP
VAPSADPRDNARRWVQGEVIDWAGTAGSAPEPLPLPGYPFEPVRCWIRSAAPRAATPTPT
RPAGSSGPALTTVLRLVSGVTGYPMTELDPAASFHDHGLDSLALLRLAGDVSAAFDLPVG
PDQLLATPTAAALADWLAREHPQGAPARPAEPEPDDPVVIVGMAGTLPGSADLDEFWAAL
ERGGDLFTEVPADRWDAREHHGDPAAHPERTRVTRAGFIGGIDRFDPLFFGISPREARWM
DPRQRLLMRTVWAALEDAGMDPGALAGSDTGLFVGVGSGEYAELVQRSGAATDAYSSTGL
APSMLANRISYQLDLHGPSEPVDTACSSSLVALHRAAEALRLGRCGTVIVGGVSLMLSPV
TFASLERAGMLSEDGVGRAFDADASGYVRGEGVGAVVLKRLSRARADGNPILAVLRGTAV
NHGGRANSLTAPSPRAQADVIRRAHREAAVDPATIGYLETHGTGTVIGDPAETNGLREAF
ADLYQDWGHDAPARPHCALGALKNTIGHLEPAAGIAAVLRVLLSMRHGRITGDPHGPRPN
PHLGLEGTPFELATGPREWAPPAPGVPRRAGVSAFGYGGANAHVVLEEYPAEEPVPAPGP
VVFVLSARDPERLRAYARSFADRPDRWAHDLASTAYTLQVGRGAYPERLAFVTDSAEHAV
ATLRRFLAGDTAGIHTGRVERDADRTPCDGRGDDETAAAWTRGAQVDWHRRWAAPPRRRS
LPTYPFAQERHWFTDGTTARPVSCFTATWQDEPVPAAGEHPGRVLVLGDLPVPGAVHVRA
GTEYRDEGPVITIRPGEQDDYARLLAETPARIVHQWPLLAPGRDDLGLEAMFRIAKELTA
GAARTPVRIQALVPEDALAEAWGGFDASLRAALPGTTFGVVRVDGAGDTGELLAEIAAHR
LSGPAVRLSPSGRSVRVLSEIPARPVLPSPLRDGGVYLITGGLGGLGVLLARTLLSRGAR
VALTGRSPAAERAEQLAELRAHGTVAYYRAAVEDRDAMTRVVAEVIADLGGLDGLFHLAG
TASRNPLPGKDVDELRAHLRARITGTRVLDEVTRDLPLDLFVLYSSLAGQLGDYGLVDYA
VGARYLDGFADFRERERLAGRRHGRTVSVDWPMWRAGGMHVDTDDERRYLAGTGFRYLET
AEGEQVLDLVLRLDRPQVAVLPGDPARMRDLVAGMRLRDDGVPALPAPPPTPAPAVAVSP
ELPTQLRELIGGILGIAPSALDPDAGFGEYGLDSFGLQNLAAALAARYDVTVPTTTLFGA
NTVTKLAAHLAAELPPAPVAKRTEPGPASSEPGPASSESAPAPVSVPHGVPAPAPVSVPH
GVPAPASGSSSAAPAGHEPIAIIGLAGRLPGADDLEQFWQHLADGRDLITETPADRWDWR
EVARRFGGTARWGGFLTGVDLFDPLFFRISPAEAQAMDPQHRLFLEHTWGALEDAGCRPD
RLAGGRVCVFAGVQFADYESMVLRGEHVNAHAGTGLARTMLANRISYLLDLRGPSESVDT
ACSSSLVALHRAVRSLRAGESDLAIAGGVSLVLSPQTVVAGNQLGVLAPDGRCKALDESA
DGYVKGEGVGVVVLKTLSRALADGDRVHAVIRGSAVNHGGRASSLTSPNPLAQADLLVEA
YGDADVPIETVSYVELHGTGTALGDPVEIDGLVRAHRALAAGPPVTCGIGTVKSNIGHLE
PAAGIAGVIKVVLAMRHRQLPPTLHLSRLNPLIDLDGTPFEPVRETRPWTPSDADGTTVP
LRAGVSSFGFGGVNAHVVLEEPPVTSVPVDSTGPEIFVLSARDEAALHRYARAHLAFLGD
RQPALSSLAHTSQVGRVPMPVRLALVVRSVAELRDRLAAFLAGDIEATTATGDHDWLTEP
EGVSYLRRLAREGRLDRIARLWQAGAAVDWAALRTDRPALTSMPTYPFARERHWLASPSA
APPEHEARRLLAKEWEPAPAASGPAPTAPVVLVRAETEALATAAFGDTARVVRLDDTDEE
TGLRAAASIGRAPVVIDLVDLSAVPVPDVRVDWARIVLARELIATNRTAGFAYLHLTRGL
VSFRAHSPTLRGAAFAGLVRMLSAEYRGVFARTVDVDFTDPDALRDVAGAELAATDPVTE
VCVRDGVRYTPTLRPTGCATAPARWSDDLAGRPVVITGGTGALGRLLAAELVERGANRLV
LLGQSPLPARDNWAELMAAPDTDPALAARLRDLSALERAGVRLVIESIPLERAREVLDRI
RREWGPIAGIVHCAGLGVMTDPAFIGKRTADMRRVVEPKTTGLQALLDACGDDPLRFVVL
YSSIAGQVPALAAGMSDYALANSVLDRVAEYRNATGADTPVFRSVQWPSWQAAGMPEVDT
PVYRELGLRTLRPQDGVALLDAALAGPDPVVLPCLVDTTRFDARALLEVAVPGSSVPGTS
APGTPVPGASGPGTSAPGTPAPRASGPGTSALETTDPGTSVPGHPAPGALAPVAAADPPT
AHGRRTGDGVRRLTEVFATTLRLDAAQIRPDADFADLGVDSIMIVQLLAALERDLGVVAE
PSALLENPTIARLAAALDDRLPEQPAPGKPEPVRAPQPRPAQVRGPERGIAVVGIAAHFP
GAPDHATFWRNLVGGVDSVTEVPPSRWDADRFWHPAPQPGRTVSKWGGFLDGIEDFDPDY
FRLDPAGAAHVDPLVRQFLEAGAECLADAGLTPAEVAGRRVGVFAGARAANFGAHHAAAT
THSISGMAQNFIAAHLSHYLDVRGPAVVVDSACSSALVAVHLAAQSLRTGESDLVIAGGV
EILLDEVPFVGMSGAGALSPSGRCHTFDERADGIVLGEGVGALLLKRAEDAIRDGDRVYA
VIEGSAVNNDGRTMGITTPNPRAQREVVESALAAAEVSPVQLGYVEAHGTGTMIGDPMEL
KALTEVLRGATDEVGFCGVGSVKTNIGHTLSAAGIAGLIKVVLSVHHGQLPPTLHCATLN
RRFEFDRSPLFPVRELRDWTGRDGVRRAGVSSFGFGGTNAHMVVRQAPDGHVPLREPLDP
PRYRRRRFWFDVPVPASAGANGRHDGPTPPAPFFQIQF
selected fasta
>polyketide synthase [putative polyketide synthase]
ATGGGTAACAGCACCGAGGACCGTGCCGCCCGGCTGGTCGTCCTGTCGGCGGGCGGCCGC
GACCAGCTCGACCGGTACCGTGCCGAGCTGGTCGGCTGGCTGCAGGCGCACCCGGAGGCG
GCACTCGACCGCATCGAGAGCACCCTGCGCACCGGTCGCGAGGAACTGGCCGAACGACTC
GCCGTGGTCGTGACCGGCGTCGCCGAGCTGACCGAGCGGCTGCGCGACGGCACCGGGGTG
GTCACCGGCACCGCCGGGCCGGCCACCGGCGAGCCCGTCCAGGCCGCGGATCTCCACGAG
GCCGCCCGACTCTGGGTCACGGGCACCCCGGTCCGCTGGCCGGAGCAGGCGAGCGGGCGC
TCGGCCCGGCTGTCACTGCCGCAGCCGCAGCCGGTGACCCGCCGGTACTGGATCGAACCG
CCCGCCGCCCTCACCGCCGATCCGGCCGAGCGGCTGCTCACCGGCGACGAGTTCTTCCTG
CGTGACCACGCGCTGGGGCAGGTGCGCGTCCTGCCCGCCGTCGCGGCCCTGGAGTTCGCC
GTCGACACCGCCGCCCGCGCCGGGCACGGGCGCGCCACCGGCGTCGACCACGTCCTCTGG
GCCCGGCCGGTCCTGTTCACCGGCGAACCGGTCCGGGTACGGCTGCGGTTCGCGCCGGCC
GCCGACGGTGTCGCCTACGAGCTGCGGCGCCTCGACGACACCCCGGACGGTGAGCTGTGC
TCGACCGGAACCCTGCGGTTCGGCCCCACCGAGCCGGCCCCGTCCCTCGACCTGGCCGCG
ATACGCGCCCGTCTGCCACGGACGACCTCGGCGGACGACTGCTACGCGGTCTTCGCCGCG
CTCGGCGGCGGGTACGGGCCCAGCCTGCGCGGACTGCGGTCCATGCGTTCCGTCCCCGGC
GAGGCGCTGGCCGAGGTCGCCGTCCCCGACGCCGCGGACCTGCCGTTCGACGACTTCACC
CTGCACCCGTCCCTGCTGGACGCCATGCTGCAGGCGGCGCTCTGGACCGCCGCCGACCCG
TCCGCGCCCAGGCCCCGCGAACTGCCCTTCTCCATCGACCGGGTGGAGATCCTCGGCCCG
CTGCCGGAACACGGGTACGCCCATGCCGTCGCCACCGGGACCGGCCACGACATCGCACTC
GCCGACGCCGACGGCCGCATCGCCGTCCGTCTGCGCGGCGTGGTCACCCGCTCCGTCAAG
GATCCGGCCGACCCGGTGGACACCCACCTGCTGGCGCAGCGCTGGCAGGACGCCCCCGTC
CGCCGCGGCGCCCCCGCCACCGGCCGCAAGGTGATCCTGGAAGCCGGTGAGGACGGGTGC
TTACCGGACTCCGGCCCACTCGTGGTGGTCCGCCTCGGTGACGACGACCCGCTGCCCAGC
CTGGTCCGGCTCTTCCGGACCTGGGCCGCGCAGCCGAACCGGCAGCCCCTCCGCGTGCTG
CACGTCTTCCGCCCGTCCGGCGCCGTCACCGACGCCCGCCTGCTGGCTCTGGACGGCATG
GCGCGCAGCATCGCCAACGAGCACCCGGACTTCCGTGCCGCAGTGATCACGACCGACGGC
GCCGACCCGCGAGCGGTCGCGGACGCCGAGGCCGCGGCGGACCACGAGTTCCGGGTCCGA
TACACCGCCGCCGGCCGGCAGGTGGCCCGATGGGAGCCGATCGCCCCCGCGCCGGCGCCG
TTGACGCCGGAGGGGACGGTGCTGGTCACCGGCGGCGCCGGCGCGCTCGGCCGACACCTC
GTCAGCCACCTGGGCCCGTCGGCCCGGTACGTGCTCACCGGCCGTTCCGCCGACGCCGAC
CTGACCGACCTGCGCGCCACCGGGCTCGACGTCCACTACCTGCCCTGCGACCTGGGTGCA
CCCGGCGCGGCCGAGCGGCTGGTCGAGCGCGTCCACCAGAGGTTCGGCCCGTTGCGCGGG
GTGCTGCACCTGGCCGGGGTCACCCGTGACTCGTTCCTGCTGCGCAAGACCGACGAGGAC
ATCGCCGCGGTGCTGGGGCCGAAGGTCGACGGCACGCTCGCACTGGACCGGGCCACGGCC
GCGGACCCGCTCGACTTCTTCGTCTGCTTCTCCTCGATGTCCGGCGCGGGCAGCCCGGGC
CAGGCCGACTACGCGTACGCGAACCGTTTCCTCGACGCGTTCGCGGCCTGGCGGCGCGGC
AGCGACCGCCCCGGCCGCAGCCTCAGCGTGCTGTGGTCGCTGTGGGCCGACGGCGGCATC
CGGATGGACGCCGACGACACCACACAGGCCCGCATCGCCCGCCGCGCCGGACTCCGGCCG
CTGCCGACCGCGGACGCCCTGCGCGCCTGGGACCGGGCGCTGGGCCACGACGGCGATCAC
GTGCTCGTGGCGCACGGTGAGCTGGATCGCATCCGCGCCCTGCTCGACGCGCCGGCGCCG
GAACCGGCCCCCGCACCGGAACCGGCGCCGAGGGCCGCCACCGGGTCGGCCACCGCGGCC
GCCGAGGAGTTCCTGCGCGGCGTGCTGGCCGAGGTCCTCCAGTACCCGCAGGAGGAGATC
GAGGCGGACACCGCGTTCGAGCAGTACGGCATCGACTCGCTGTTGATCATGGATCTGACC
CGGCGGCTCGAGGACCACTTCGGATCACTGCCGAAGACCCTCTTCTTCGAATACCAGGAA
CTGCGCGGGCTCGCCGGCTGGTTCGCCGAGCACCACGGCGGCCGCCTCGCCGAACTCACA
CCGGCACCGGCTCCGGTGCCGGTGCCGGTGCAGGCGCCGGTCGTGGTGGCCACACCGGAT
GCCGCCCCGAGCGGCGAGCGTCCCGCGCCGCCCTCCGCGGACGCCCCGGAACCCGTCGCG
ATCATCGGCGTCGCGGCCCGGTTCGCCGAATCCGACACCCTCGACGAGTTCTGGGCGAAC
CTGCGAGCCGGCCGTGACCTGATCACCGAGATTCCGGCGGACCGCTGGGACTGGCGCGAC
TACGACGAGGCCACCCCGGCGGACCGCGCCGCCGAGTACAGCCGGTGGGGCAGCTTTCTG
CGCGGTATCGACCGGTTCGACCCGCTCTTCTTCGGCATCTCCCCCCGAGAGGCGGAGATC
ATCGACCCTCAGGAGCGGCTGTTCCTGCAGACCGCCTGGCACGCCATGGAGGACGCCGGC
CTCACCCGGGCCGACCTGCGCGCCCGCCGCGTCGGTGTGTACGCCGGCGCCATGTACGGC
CTGTACCAGCTCCACGAGGCCGCCGACGGCCGAATCGGCGCGTCGTCGCACGCGTCCATC
GCCAACCGGGTCTCGTACACCCTGGGCGTGACCGGCCCCAGCCTGGGTGTGGACACCATG
TGCTCCTCGTCGCTGACGGCCATCCACCTCGCCGTGCGCGACCTGCGGTCCGGCGAGGCC
GAAATGGCCCTCGCCGGGGGTGTCAACCTGCACGTCCACCCGTACAAGTACCGGTTCCTC
GGCCAGGGCACCTTCACCTCCAGCGACGGCCGTTGCCGCAGCTTCGGCGCGGACGGCGAC
GGCTACGTGCCCGGCGAGGGCGTCGGCGCGGTGCTGCTCAAGCCCCTGTCGGCCGCCGTC
CGCGACGGCGACCACATCCACGGCGTCATCCTGGGCAGCTCCGTCAACCACGGCGGCAGG
ACCAACGGCTTCACCGTGCCCAACCCGGTCGCCCAGAGCGACCTCGTCGAGCGTGCCCTG
GCCGAGGCCGGGTGCTCCGCCGCCGCACTCGGCTACCTGGAGGCACACGGCACCGGCACC
GCACTGGGCGACCCGGTGGAGGTCCGGGCCCTGGCCCGCGCGCTGGGCGCCTCCGGCCTG
CCCCGGGGCAGCCTGCCGATCGGCTCGGTGAAATCCAACATAGGCCACCTCGAATCGGCC
TCCGGCATGGCCGGGCTCTGCAAGGTGCTCCTGCAGATGCGGCACGGGGAACTGGTGCCG
TCGCTGCATGCCGACCCGGTCAATCCGAACATCGACTTCGCCTCCACGCCACTGCGGGTG
CAGACCGAGACGGCCCCGTGGCCGCGCCGGGACGGCCTGCCGCGCCGCGCGGGGATCAGT
TCGTTCGGCGCGGGCGGAGCCAACGCCCATCTGGTCGTCGAGGAGTACGTTCCCGGGCCG
GCGCCGGCTGCCGCACCGGGCCCCTGGCTCTTCCCGCTCTCCGCCCGCACCCCGGAGGGC
CTGCGCGCGCTGGCCGAGCGGCTGGCCGACGCGGTGGACAACGGCCTCGCCGACCGGCTC
GCCGACGTGGCGTACACGCTGCAGCACGGCCGCGAGGCCTGGGCCGACCGCATGGTGGTG
CTCGCCTCCACGGCGGACGAGCTGGCCGGTCGGCTGCGCGCGGGCACCGGAACCGGCGTG
TGGACGGGCAGCGTCCGCGGCCGTGCCGCCTCCCGCGCCGCCGCGCCGGCCGCCGCGGAC
CCGGCCGGCCTGGCTGCCGCCTGGACCTCCGGCGCGACCGTCGCCTGGCCCGGCACCGGG
CGACGGCTGCCGTTGCCCGGCTACCCGTTCGAGGAGCTGCGCTGCTGGCTCACCGAGCGG
ATGTGGGCGCCGTCGCCGGCCGGCCCGGCCACGCATCCGCTGCTGGACGAGATCGTGCCG
GCCGACAGCGTGGACGGCCTGACCTTCCGCACCGCCTTCGCCCCCGCGCATCCGCTGATA
GACGGGCACCGCGTCGGCGACCTGCGCCTGCTCCCCGCCGCCGCGGTGCTGGAGATGGCC
CGGGCCGCCGCCGCGCACGCCGGATACCCCGTGCCGGTCAGGCTGCGCGACGTTCGGTGG
CTACGGCCGCTCGTGGTCACCGGGACCGTGGCCTCCGCCCGCACCCGGCTGCGCCGCGAC
GGCGCCGGCCTGGCCTTCACACTGCTCGGCGACACCGGCGACCAACTGGCCCAGGGCCTG
GTCGAGGCACGGGCCGACGACGTGCCGGAGCCGGTACCCGTCGAGCGGATCCGGGCCGCC
CTGCCGCACCGGCACGACGGCGCGGACCTCTACACCGACCTGGCCGGAGCCGGCCTGGTC
TACGGCCCGGCGCTGCGTGCCGTCGAGTGGATCGCCTCCGGCACCGACGAGGCGCTGGCG
AGTCTGCGCGTGCCCGCCGAAGCCGCCCGGTTCGCCGACTGCGCACTGCCACCCGCGCTC
ATCGACGGTGCCCTGCACACGTTCGCGGTGCTGCGCGATCGCGCCGGCGGCCCGATGGTG
CCCTTCGCGCTCGCCGCCGCCGAGGTGGTCGGACCGCTGCCCGAGCATGTGTACGCCCAT
GTGCGCACCGTCGGCCCGGACCGGTACGACCTGACCCTGACCGACCCGGACGGCGGCGTT
CTCGTCCTGCTGCGCGACCTGTGCCTGCGCCCGGCTCCCGCAGCGGGGACGTCCGACGCC
GGGCCCGCCGTGACCGCCGTGACCGCCGGGCCCGCCGTGACCGAGCGGCCGGTGGATGAC
CTGATGTACCTGCCCCGCTGGTCCCCGGTCGCGGCCGAGCCGTTCACCGTGCCGTCGACC
GCGCCCGGCTCGGACACCTGGCTGATCCGTCCGTCCTGCGCCGCGCCCCTCGCCGCCGCC
CTCGCCACCCGGCTCGGCGGTTCCGTCACCGAGATCGAGCCCGAGCACTTCGTCGCACCG
GCCGGGCGTCCCGGCCACGTGATCGTGCTGTCCGGCCCGGCGCAGGGGCGCACCGACGAC
CCCGCCGCCCTCGACCTCGCGCAGGAGCGCGGCGTCCTGGCCCTCTTCCGCGCAGCGAAG
GCGCTGCAACGGTCCGGCGCACCCGTACGGCTGACGGTGGTCACCGAGGACGCGCTGAGT
ACCGGCACCGAACCGGTCCGCAACCCGTACGCGGCGAGCCTGCACGGACTGGCTCTGTCC
CTGGCCCAGGAGCAGCCGCGCTGGCGGGTGGCCGTGGTCGACCGCTCCTCGGCCGACCCG
ATCTCCCCGGACGTCCTCGACGTGCCGGCCGGTGGCCCGTACGCCCTGCGCGCCGGCGTC
CTGCACCGGCGGAGCCTGGTCCCCGCCGCCCCCACGACGACGCGCGAGGCGATACGCCAC
GGCGGTGTCTACCTGATTCTCGGCGGTGCCGGAGGACTCGGCCTGGAGCTCACCGAATGG
CTGGTGCGCGGCTACCGGGCCAAGGTCGTGCTGGTGGGGCGCAGTGAACTCGACGCCGGC
CGGCGCGACCGGCTGCGCCGCCTCGACCCGGCCGGCGCCCTCGTCTCGTACCGGCGGGCC
GACGCCACCGACCCCGCGGCGCTGGCCGAGGTGGTCACGGCGGTCCGTGCCGAGCACGGG
ACGCTGCACGGGGTCGTGCACGCCACCATCGTGCTGCGCGACCAGACCGTCGCCACGATG
ACCGAGGACACCTTCCGGGCCGTGCTCGACGCCAAGACCCGCACGTCGGTGGCACTGCAC
CGCGCCCTGGTCGCCGCCGACGGGCTCGACTTCGTCCTGTTCTTCTCCTCGGCGGTGGCC
CTGTCGGGCAGCGCCGGGCAGGCCAACTACGCCGCCGGATCGACGTTCGAGGACGCGTTC
GCACACCATCTCGACGACGTGCTGGCCGCCCGCTCGGCCGTCGTCAACTGGGGCTACTGG
GGCACCGTCGGCATCGTCGCCGACGACCGGCACCGCGAGCGCCTGGCCCGGACCGGGATC
CACTCGATCACCCCGGCCGAGGGCATGGCAGCCGTGCACGACGTGCTGGGCCGCACCGAT
CGGCAGGTCGTCGTGATCAAGGCGACCGCCGAGGTGCTCGCCGCCGCCGGAGTCGAACGG
CCCGCCGGTGAACGGTCCGACGACGAGCTGGCCCCCTCGGCGGCGGCGCTGCCGCCGGTC
GCCCGGCTGTTGACCGAGACCGACCAGGCGCGTCTGGACGAGGTCGTGCTCGGCTGGCTG
TGGGAACTGTTCCGGGGCGAAGGGGTGTTCCGGACGGTCGGCGAACGGTGGAGCGCCGAC
GAGCTGCGGCGGCGGCTGCGGATCGCCGACGGGCAGTCCCGCCTCTTCGCCGAACTGCTG
CGCGTGCTCACCGTCGCCGGTTTCCTGCGCGACGACGGCAGCGCGCTGATCGCCACGGAC
CGCCGGGCTCCCACCGACCCGGAGAACGAACTGGTCGTGCTCTGCGAGGGGCAACCCGCG
CTGAACCGCATCGACCGGCTGCTGAGGCCCTGCATGCACCAGCTGTTCGGGGTGCTCCGC
GGCACCGTCCGCGCGACCGAGGTGATGTTCCCCGGCGGATCCACGGAGCTGGTGGAGGGC
GCCTACCGGGGCAGCCCGGTGGTCGACCGCGCCAACGAACTCGTGGTCGCCGCCGTGCTG
GACCGGGTGGGCCGGCTCGGCGGACCGGTGACGGTCGTCGAGGTCGGCGCCGGAACCGGC
GGCACCACCGCGAGCCTGCTGCCCGCGCTGGCCGCCACCGGCGTGGAACTGACGTACGTC
TACACCGACATCTCGCCCGCCTTCCTGCAGCACGGCCGACAGCGGTTCGCCGAGCGCTAC
CCGATGGTGCGCTTCCAGCAGCTCGACATCTCCGGCGACCCCCTCGCGCAGGGCTTCCCG
CCCGGCGGCGCGGACGTCGTGGTCGCGGCGAACGTCCTGCACGCCACCCCGGACCTGCCG
CACACCCTGCGCGCGGTCGCGCTGCTGCTCAAATCCGGTGGGCACCTGGTGCTCAACGAG
GCCACCAGCAACGTCGTCACCGCCACGCTCACCTTCGGTCTGCTCGACGGCTGGTGGCTG
CACCGCGACACCGGCCTGCGTCTGCCCGGTTCGCCGCTGCTGTCCGGACGCGGCTGGCGC
GCCGCGCTCGACCTGGCCGGATTCACCCGCAGCCGGGCTCTGCCCGCCGACGAGGGGCTC
ACGCAGCACGTCGTCGTCGCGGAGAGCGGGCCGGCCGGGCCGGCTGCCGTCACCGCACCC
ACGGCGCAGCCGGCGCCGCCACCAGCGGCCGAACCGGCGCCCGAGCCGCGTACCGGCGGC
GGGGGCCGGCTCGTCGAAGCCGCCCGCGACTACGTCAAGGACGCGTTCGTGCAGGTACTC
GAGGTGCCCCGGGACCGGCTGTGGCTGGACGAGACGTACGAGAACTTCGGGGTCGACTCG
CTCACCGTGCCCCGCATCGCCGACCTGCTCGCCGAGCGCATGGGCGACCTGCCGCCCACT
CTGCTGTTCGAACACCCCACCATCCGCGAGGTCGCCGACCACCTGGTCGAGCGGTATCCG
GACCGGGTGCGGGCCCTGCTGCCCGACCAGCCCCGGCCCGCGCCGGCCCAGGCCACCGAG
CCCGCGCCGGCCCAGGCCACCGAGCCCGCGCCGGCCCAGGTCACCGAGCCCGCGCCGGCC
CAGGTCACCGAGCCCGCCGGACGGCCGGCAAAGACGGCACCGGCCGCGGACACCCGGATC
GCCGTCATCGGCGTGGCCGGCCGCTACCCGCTCGCCGACGACGTCGACGCGTTCTGGACC
AATCTGCGAACCGGGCTGGACTGCATCCGCGAGGTGCCGGCCGAGCGCTGGGATCCGCGG
ACGGAGCCCGGGGCGAACGGCACACCGGTCAGCCGGTGGGGCGGCTTCCTCGACCGCATC
GACGAGTTCGACCCGCGGTTCTTCCAGATGTCGATGCACGAAGCCGAGCTGACGGACCCG
CAGGAGCGGCTGTTCCTGCAGACCGCCTGGCACACCCTCGAGGACGCCGGCTACCCCCGG
ACCCGGCTCCGGGGCAGCCGCGTCGGCGTCTACGTCGGCGTCATGTACGGCCACTACCAG
CTCTTCGAGGACGAGCGCGGCCTGGCCGGCGGGATGGGCTACGCGTCGATCGCCAACCGG
GTCTCGTACGCGCTCGACCTGCACGGCCCGAGCCTGGCGGTCGACACCATGTGCTCGTCG
TCGCTGACCGCCATCCACCTGGCCTGCGAGGCGCTGGCCGCCGGAGGCGTGGACTACGCG
CTCGCAGGCGGCGTCAACCTCACCCCGCACCCACGCAAGTACCGGCAGCTCGCGGCCGGC
GGGTTCACCGGCGAGAGCGGCCGGTGCCGCAGCTTCGCGGCCGGCGGCGACGGCATGGTC
CCCGGCGAGGGGGTCGGCGCGGTCCTGCTCAAGCCGCTGGCCGCGGCCGAGCGCGACGGC
GACCGCATCCTCGGCGTGATCCTCGGCAGCGCGGTCAACCACGGCGGCAAGACCGGCGGG
TACGCGGTGCCCAGTCCCGGCGCCCAGAGCGAGGTCGTCACGAGCGCGCTGCGGGCCGCC
GGCGTCGAACCGGCCGACGTGTCGTACGTGGAGGCGCACGGCACCGGTACGGCGCTGGGC
GACCCGGCCGAGGTCGCCGGACTGGCCCGGGCGTTCGGCGACCGCCCGGCCGGCTCGATC
GCCATCGGCTCCGTCAAGTCGTCCATCGGGCACCTGGAGTCGGCGGCGGGCATCGCCGCC
CTGACCAAGGTGCTGTTGCAGATGCGCGCCGGGGAGCTGACGCCGTCACTGCACGCCGAG
CAGCTGAACCCGGCCGTCGACTGGGCGAACGTCCCGTTCCGCGTCCAGCGGGAGGCGGCG
CCGTGGACGGGCCCGCGACCGTTGCGCGCCGGCGTCAGCGCCTTCGGCGCCGGTGGCTCC
AACGCCCATCTGGTCGTCGAGCAGTACCGGGCCGAGCCACGGCCCGGCGTCGTGCCGATG
CCGGCCGTGTTCCCGTTCTCGGGGCGCGACGCGCAGGCGCTGCGCCGCATCGTCGAGCGG
ATGCTCAGCCGCCTGCGGGAGCTGGGCGCGACCGGCCTGCGCGGTGAGCCGGGCGCGACC
GGCCTGGCGGAGATCGCCGCGGCCGCCGGGCTGCCGGTCGGCGCCGTCGACGAGCCGCTC
GACGAGCTCGGCCTGGACCCGGCCACGATCATGCGGCTGGCAGGGCGGGAGACCGCCCTG
CACCAAGGCGCCGTGCACAGCGGATCGACGCTGCGACAGCTCGCCGCGGCCCCGCCGGAC
GCGGCGGACATCGACCTCGGCCGCCTGTCCTACACGCTGCAGATCGGGCGGGAGGCGATG
GCACACCGGCTCGCCGTGGTCGCCCACCGGACGGACGAGCTGATCGAGCAGCTCGACGCC
TTCCTCGCCGGGCGGCCCGCGGGCTGGACCGGCGTGGTGACCACGGAGCCGGGCGACCCG
GTCGCGCCGAGCGCGGATCCGCGCGACAACGCCCGCCGCTGGGTGCAGGGCGAGGTGATC
GACTGGGCGGGCACGGCCGGCAGCGCGCCGGAACCGCTGCCACTGCCCGGCTACCCGTTC
GAGCCGGTCCGCTGCTGGATCCGTTCCGCGGCCCCGCGGGCCGCCACGCCGACGCCCACC
CGGCCGGCCGGCTCCTCCGGCCCCGCGCTGACCACCGTGCTGCGGCTGGTCAGCGGGGTC
ACCGGCTACCCGATGACGGAGCTGGACCCGGCCGCCTCGTTCCACGACCACGGCCTGGAC
TCGCTGGCGCTGCTGAGGCTGGCCGGTGACGTCTCCGCGGCGTTCGACCTACCGGTCGGC
CCGGACCAGCTGCTGGCCACGCCGACGGCCGCGGCCCTGGCCGACTGGCTCGCCCGCGAA
CACCCGCAGGGCGCGCCCGCGCGACCCGCGGAGCCGGAACCGGACGACCCGGTGGTGATC
GTCGGCATGGCCGGGACGCTGCCCGGCTCCGCCGACCTGGACGAGTTCTGGGCCGCCCTG
GAACGCGGTGGCGACCTGTTCACCGAGGTACCGGCCGACCGGTGGGACGCACGGGAGCAT
CACGGCGACCCGGCCGCGCACCCGGAACGCACCCGGGTGACCCGGGCCGGCTTCATCGGC
GGCATCGACCGGTTCGACCCGCTGTTCTTCGGTATCTCCCCGCGCGAAGCCCGCTGGATG
GACCCGCGCCAGCGGCTGCTGATGCGTACGGTGTGGGCCGCGCTGGAGGACGCGGGTATG
GACCCGGGTGCTCTGGCCGGCAGCGACACCGGGCTCTTCGTCGGCGTCGGCTCCGGCGAG
TACGCCGAACTCGTCCAGCGCTCCGGCGCCGCCACCGACGCCTACTCGTCGACCGGCCTG
GCCCCGTCGATGCTGGCCAACCGCATCTCGTACCAGCTCGACCTGCACGGTCCCAGCGAA
CCCGTGGACACCGCCTGCTCCAGCTCGCTCGTCGCGCTGCACCGGGCGGCGGAGGCGCTG
CGCCTCGGACGGTGCGGCACGGTCATCGTCGGCGGCGTCAGCCTGATGCTGTCCCCGGTC
ACCTTCGCCTCACTGGAACGGGCGGGGATGCTCAGCGAGGACGGCGTGGGCCGGGCCTTC
GACGCCGACGCGTCCGGTTACGTACGCGGCGAGGGGGTCGGCGCCGTCGTCCTCAAGCGG
CTCAGCCGGGCGCGCGCCGACGGCAACCCGATCCTGGCCGTACTGCGCGGCACCGCGGTC
AACCACGGCGGCCGAGCCAATTCGCTGACCGCGCCGAGCCCGCGCGCACAGGCAGACGTG
ATCCGGCGGGCGCACCGGGAGGCGGCGGTCGACCCGGCGACGATCGGCTACCTGGAGACG
CACGGCACCGGCACGGTCATCGGTGACCCCGCCGAGACCAACGGGCTGCGCGAGGCGTTC
GCCGACCTCTACCAGGACTGGGGACACGACGCGCCGGCCCGGCCGCACTGCGCGCTCGGC
GCGCTGAAGAACACCATCGGCCATCTCGAACCAGCCGCCGGCATCGCCGCGGTGCTGCGC
GTGCTGCTGTCGATGCGGCACGGCCGGATCACCGGCGACCCGCACGGGCCGCGGCCGAAC
CCGCATCTGGGCCTGGAGGGCACCCCGTTCGAACTCGCGACCGGGCCGCGGGAGTGGGCG
CCGCCCGCGCCCGGGGTGCCACGCAGGGCCGGGGTGAGCGCCTTCGGGTACGGCGGAGCC
AACGCGCACGTCGTACTCGAGGAGTACCCGGCCGAGGAGCCGGTTCCGGCGCCGGGACCG
GTCGTGTTCGTCCTGTCCGCCCGGGACCCCGAACGGCTGCGGGCGTACGCGCGGTCCTTC
GCCGACCGGCCGGACCGCTGGGCGCACGACCTGGCGAGCACCGCGTACACGTTGCAGGTC
GGGCGCGGGGCGTACCCCGAGCGGCTGGCGTTCGTCACCGACTCCGCCGAGCACGCCGTC
GCGACGCTACGGCGTTTCCTCGCCGGTGACACCGCGGGCATCCACACCGGTCGGGTCGAG
CGGGACGCGGACCGCACGCCCTGCGACGGCCGCGGTGACGACGAGACGGCGGCCGCCTGG
ACCCGGGGCGCACAGGTGGACTGGCATCGCCGCTGGGCCGCCCCGCCCCGCCGGCGGTCG
CTGCCGACCTACCCGTTCGCGCAGGAACGGCACTGGTTCACCGATGGCACGACTGCCCGT
CCGGTCAGCTGCTTCACGGCGACCTGGCAGGACGAGCCGGTCCCGGCGGCCGGCGAGCAC
CCGGGCCGGGTACTGGTCCTGGGCGATCTGCCGGTGCCCGGCGCCGTGCACGTGCGCGCC
GGCACGGAGTACCGCGACGAGGGCCCGGTGATCACCATCCGGCCCGGCGAGCAGGACGAC
TACGCGCGGCTGCTCGCCGAGACGCCCGCCCGGATCGTCCACCAGTGGCCGCTGCTCGCG
CCCGGCCGCGACGACCTGGGACTCGAGGCGATGTTCCGGATCGCGAAGGAGCTGACGGCC
GGCGCCGCCCGCACCCCGGTCCGGATCCAGGCGCTGGTGCCGGAGGACGCGCTCGCCGAG
GCGTGGGGCGGGTTCGACGCGTCGTTGCGGGCCGCGCTGCCGGGAACGACGTTCGGCGTC
GTCCGGGTCGACGGTGCGGGCGACACCGGCGAGCTGCTCGCCGAGATCGCCGCGCACCGG
CTGTCGGGCCCGGCCGTGCGGCTGTCGCCGTCGGGCCGGTCGGTGCGGGTGCTCAGCGAG
ATACCCGCCCGTCCGGTGCTGCCCTCACCGCTGCGTGACGGCGGCGTCTATCTGATCACC
GGTGGCCTCGGCGGGCTGGGTGTGCTGCTGGCCCGAACGCTGCTGTCACGTGGCGCCCGG
GTGGCGCTGACCGGTCGCTCGCCGGCCGCCGAACGGGCCGAGCAGCTGGCGGAGCTGCGC
GCGCACGGCACCGTCGCGTACTACCGGGCGGCCGTGGAGGACCGCGACGCGATGACCCGC
GTGGTGGCCGAGGTGATCGCCGACCTGGGCGGCCTCGACGGGCTGTTCCACCTGGCCGGC
ACCGCGTCGCGCAACCCGCTTCCCGGCAAGGACGTCGACGAGCTGCGGGCGCACCTGCGC
GCCCGGATCACCGGAACCAGGGTTCTCGACGAGGTCACCCGCGACCTGCCGCTGGACCTG
TTCGTGCTCTACTCCTCGCTGGCCGGGCAGCTCGGTGACTACGGCCTGGTGGACTACGCG
GTCGGCGCTCGCTACCTCGACGGGTTCGCGGACTTCCGGGAGCGGGAGCGTCTCGCCGGC
CGCCGCCACGGCCGTACCGTGTCGGTGGACTGGCCGATGTGGCGTGCCGGCGGCATGCAC
GTGGACACCGACGACGAGCGCCGCTACCTGGCCGGTACCGGCTTCCGCTACCTGGAGACG
GCCGAGGGCGAGCAGGTGCTCGACCTGGTGCTGCGCCTGGACCGCCCGCAGGTGGCCGTC
CTGCCCGGTGACCCGGCCCGGATGCGCGACCTGGTCGCCGGGATGCGTCTGCGCGACGAC
GGCGTACCGGCCCTCCCGGCGCCGCCGCCGACCCCCGCGCCGGCCGTCGCCGTCTCCCCG
GAACTCCCCACCCAGCTGCGGGAGCTGATCGGCGGGATCCTCGGGATCGCCCCGTCCGCT
CTCGACCCCGACGCCGGCTTCGGCGAGTACGGCCTGGACTCCTTCGGCCTGCAGAACCTG
GCCGCGGCACTGGCCGCCCGTTACGACGTGACCGTGCCGACGACGACGCTGTTCGGCGCC
AACACGGTCACCAAGCTCGCCGCGCACCTGGCGGCCGAGCTGCCTCCGGCCCCGGTGGCC
AAGCGGACCGAGCCCGGCCCCGCGTCGTCCGAGCCCGGCCCCGCGTCGTCCGAGTCCGCG
CCCGCACCGGTGTCCGTGCCGCACGGCGTGCCCGCGCCCGCACCGGTGTCCGTGCCGCAC
GGCGTGCCCGCGCCCGCGAGCGGCTCGTCGTCCGCCGCTCCGGCCGGTCATGAGCCGATC
GCCATCATCGGCCTGGCCGGGCGGCTGCCCGGCGCGGACGACCTCGAACAGTTCTGGCAG
CACCTCGCCGACGGCCGGGACCTGATCACCGAGACGCCCGCCGACCGATGGGACTGGCGG
GAGGTCGCCCGCCGCTTCGGCGGCACCGCCCGCTGGGGTGGCTTCCTGACAGGCGTGGAC
CTCTTCGACCCGCTGTTCTTCCGTATCTCACCGGCCGAGGCGCAGGCCATGGACCCGCAG
CACCGCCTCTTCCTGGAGCACACCTGGGGCGCGCTGGAGGACGCCGGGTGCCGCCCGGAC
CGGCTCGCGGGCGGCCGGGTGTGCGTCTTCGCCGGGGTGCAGTTCGCCGACTACGAGTCG
ATGGTGCTGCGCGGCGAGCACGTCAACGCTCACGCCGGCACCGGTCTGGCCCGCACCATG
CTGGCCAACCGCATCTCGTACCTGCTCGACCTGCGGGGCCCGAGCGAGAGCGTCGACACG
GCCTGCTCCAGCTCGCTGGTCGCCCTGCACCGTGCCGTGCGGTCGCTGCGCGCGGGGGAG
AGCGACCTCGCCATCGCCGGTGGGGTGAGCCTCGTGCTGTCCCCGCAGACCGTGGTCGCC
GGCAACCAGCTCGGCGTGCTCGCGCCCGACGGCCGGTGCAAGGCGCTCGACGAGAGCGCC
GACGGGTACGTCAAGGGCGAGGGGGTCGGCGTCGTCGTGCTCAAGACGCTGTCGCGGGCC
CTCGCCGACGGCGACCGGGTGCACGCGGTGATCCGCGGCAGCGCCGTCAACCACGGCGGC
CGCGCGTCGTCGCTCACCTCGCCGAACCCGCTCGCGCAGGCGGATCTGCTGGTCGAGGCG
TACGGGGACGCGGACGTGCCGATCGAGACGGTGTCCTACGTCGAGCTGCACGGCACCGGC
ACCGCCCTGGGCGACCCGGTCGAGATCGACGGCCTGGTCCGCGCCCATCGCGCGCTGGCC
GCCGGGCCGCCGGTCACCTGCGGCATCGGCACGGTCAAGAGCAACATCGGGCACCTGGAG
CCCGCGGCGGGCATCGCCGGCGTGATCAAGGTGGTGCTGGCGATGCGGCACCGGCAGCTG
CCGCCGACCCTGCACCTGTCGCGGCTCAACCCGCTGATCGACCTGGACGGCACTCCCTTC
GAGCCGGTCCGCGAGACCCGGCCGTGGACACCGAGCGACGCCGACGGCACGACCGTGCCA
CTGCGCGCCGGGGTCAGTTCCTTCGGCTTCGGCGGGGTCAACGCCCATGTCGTCCTGGAA
GAGCCGCCCGTGACGTCCGTGCCCGTGGACTCCACGGGGCCGGAGATCTTCGTGCTGTCG
GCGCGGGACGAGGCCGCCCTGCACCGGTACGCCCGGGCACACCTGGCATTCCTCGGCGAC
CGGCAGCCCGCGCTCTCCTCTCTCGCCCACACCTCGCAGGTGGGCCGGGTTCCGATGCCG
GTGCGCCTGGCCCTGGTCGTCAGGTCCGTGGCCGAACTGCGGGACCGGCTGGCCGCCTTC
CTGGCCGGTGACATCGAGGCGACCACCGCGACCGGCGACCACGACTGGCTCACCGAGCCG
GAGGGCGTCAGCTACCTGCGCCGGCTGGCCCGGGAAGGGCGGCTCGATCGGATCGCCCGC
CTCTGGCAGGCCGGCGCGGCCGTGGACTGGGCCGCGCTGCGCACCGATCGGCCCGCCCTG
ACGTCCATGCCGACGTACCCGTTCGCCCGGGAACGGCACTGGCTGGCGAGCCCGTCCGCC
GCGCCGCCGGAGCACGAGGCGCGACGCCTGCTGGCCAAGGAGTGGGAACCGGCGCCGGCG
GCGTCGGGGCCGGCGCCGACCGCGCCGGTGGTCCTGGTCCGGGCCGAGACCGAGGCGCTG
GCGACGGCGGCGTTCGGTGACACGGCCCGAGTGGTCCGCCTGGACGACACGGACGAGGAG
ACGGGGCTGCGGGCGGCCGCGTCGATCGGCCGGGCGCCGGTCGTGATCGACCTCGTCGAC
CTGTCCGCGGTGCCGGTGCCCGACGTACGCGTCGACTGGGCCCGCATCGTGCTGGCCCGT
GAGCTGATCGCGACGAACCGAACCGCCGGCTTCGCCTATCTGCACCTGACCCGAGGACTG
GTGTCCTTCCGCGCGCACAGCCCGACGCTGCGAGGAGCGGCGTTCGCGGGACTGGTCCGG
ATGCTCTCCGCCGAGTACCGCGGGGTGTTCGCCCGCACCGTCGACGTCGACTTCACGGAC
CCGGACGCGCTGCGCGACGTGGCCGGCGCGGAGCTGGCGGCGACCGACCCGGTCACCGAG
GTGTGCGTGCGTGACGGCGTCCGGTACACGCCGACGCTGCGTCCCACCGGCTGCGCCACG
GCACCCGCCCGGTGGTCGGACGATCTGGCCGGGCGGCCGGTGGTGATCACCGGCGGCACC
GGCGCGCTCGGCCGTCTGCTGGCCGCGGAACTCGTCGAGCGGGGAGCAAACCGGCTGGTA
CTGCTCGGCCAGTCCCCGCTGCCCGCCCGCGACAACTGGGCGGAGCTGATGGCCGCACCC
GACACCGATCCGGCGCTGGCGGCCCGACTGCGCGACCTCAGCGCGCTGGAACGCGCCGGG
GTGCGCCTGGTGATCGAGAGCATCCCCCTCGAGCGCGCCCGGGAGGTACTGGACCGGATC
CGGCGGGAGTGGGGACCGATCGCCGGGATCGTGCACTGCGCCGGTCTCGGCGTGATGACC
GACCCGGCTTTCATCGGCAAACGCACCGCCGACATGCGGCGGGTGGTGGAACCGAAGACC
ACGGGCCTGCAGGCGCTCCTGGACGCGTGCGGCGACGACCCGCTGCGCTTCGTGGTGCTG
TACTCGTCGATCGCCGGTCAGGTGCCCGCGCTGGCGGCAGGGATGAGCGACTACGCGCTG
GCCAACTCGGTGCTGGACCGGGTGGCCGAGTACCGGAACGCCACCGGCGCCGACACGCCG
GTCTTCCGGTCGGTGCAGTGGCCGAGCTGGCAGGCGGCCGGCATGCCGGAGGTGGACACC
CCTGTCTACCGGGAACTGGGGCTGCGGACGCTGCGCCCGCAGGACGGCGTGGCGCTGCTG
GACGCGGCGCTGGCGGGACCCGACCCGGTCGTGCTGCCGTGCCTGGTGGACACCACCCGG
TTCGACGCCCGGGCCTTGTTGGAGGTTGCCGTGCCCGGGAGTTCTGTGCCCGGGACTTCC
GCGCCGGGGACTCCCGTGCCCGGGGCGTCCGGGCCCGGGACTTCCGCGCCGGGGACTCCC
GCGCCCAGGGCGTCCGGGCCCGGGACTTCCGCGCTCGAAACCACCGATCCCGGGACTTCG
GTGCCCGGGCACCCCGCGCCAGGGGCCTTGGCGCCGGTCGCCGCCGCGGACCCGCCCACG
GCTCACGGGAGGCGGACCGGTGACGGCGTGCGGAGGCTCACCGAGGTCTTCGCGACGACG
CTGCGGCTGGACGCCGCCCAGATCCGGCCCGACGCCGACTTCGCCGACCTCGGTGTGGAC
TCCATCATGATCGTCCAACTGCTCGCCGCGCTGGAACGTGACCTCGGGGTGGTCGCCGAA
CCCTCGGCGCTGCTGGAGAACCCGACCATCGCCCGGCTGGCCGCCGCCCTCGACGACCGG
CTGCCGGAGCAGCCTGCGCCCGGGAAGCCGGAGCCGGTGCGCGCGCCGCAGCCGCGACCC
GCCCAGGTGAGAGGGCCGGAGCGGGGAATCGCGGTGGTGGGCATTGCCGCCCACTTCCCC
GGAGCGCCCGACCACGCCACGTTCTGGCGCAACCTCGTCGGCGGCGTGGACTCGGTGACC
GAGGTGCCGCCGTCGCGCTGGGATGCCGATCGCTTCTGGCACCCCGCCCCGCAGCCCGGC
AGAACCGTCAGCAAGTGGGGCGGATTCCTGGACGGCATCGAGGACTTCGACCCGGACTAC
TTCCGGCTCGACCCGGCCGGGGCCGCCCACGTCGACCCGCTGGTGCGGCAGTTCCTGGAG
GCCGGGGCGGAGTGCCTGGCCGACGCGGGCCTGACGCCCGCCGAAGTGGCCGGTCGCCGG
GTCGGGGTCTTCGCCGGCGCCCGGGCGGCGAACTTCGGCGCGCACCATGCCGCCGCGACG
ACCCACTCGATCAGCGGCATGGCGCAGAACTTCATCGCCGCCCACCTCTCGCACTACCTC
GACGTGCGCGGCCCCGCCGTCGTCGTCGACAGCGCCTGCTCCTCGGCGCTGGTCGCGGTG
CACCTGGCCGCGCAGAGCCTGCGCACCGGCGAGTCCGACCTGGTGATCGCCGGCGGCGTC
GAGATCCTGCTCGACGAGGTGCCGTTCGTCGGCATGAGCGGCGCGGGGGCGCTGTCACCG
AGCGGCCGGTGCCACACCTTCGACGAGCGCGCCGACGGCATCGTCCTCGGCGAGGGCGTC
GGCGCCCTGCTGCTCAAGCGGGCCGAGGACGCGATCCGCGACGGCGACCGGGTGTACGCG
GTGATCGAGGGCAGCGCCGTCAACAACGACGGCCGCACCATGGGCATCACCACGCCGAAC
CCGAGGGCGCAGCGCGAGGTCGTCGAGTCCGCACTCGCCGCGGCCGAGGTGTCACCGGTG
CAGCTCGGCTACGTCGAGGCGCACGGTACCGGCACCATGATCGGTGACCCGATGGAGCTG
AAGGCGCTCACCGAGGTCCTGCGCGGCGCCACCGACGAGGTCGGCTTCTGCGGTGTGGGC
AGTGTGAAGACCAACATCGGGCACACGCTCAGCGCGGCCGGGATCGCCGGCCTGATCAAG
GTGGTGCTGTCGGTGCACCACGGGCAACTGCCGCCCACCTTGCACTGCGCGACGCTCAAC
CGGCGCTTCGAGTTCGACCGGTCGCCGCTGTTCCCGGTCCGTGAGCTGCGGGACTGGACC
GGGCGGGACGGCGTACGCCGGGCCGGAGTCAGCTCGTTCGGCTTCGGCGGCACCAACGCC
CACATGGTGGTGCGCCAGGCCCCGGACGGCCATGTCCCGCTGCGTGAACCGCTGGATCCG
CCGCGCTACCGACGGCGCCGGTTCTGGTTCGACGTCCCGGTACCGGCCTCCGCAGGAGCC
AACGGGCGCCACGACGGCCCGACGCCGCCGGCGCCGTTCTTCCAGATCCAGTTCTGA
[7] DH139..292
[7] KR565..738
[7] ACP821..889
[8] KS937..1304
[8] DH1512..1668
[8] KR2002..2183
[8] MT2433..2536
[8] ACP2648..2716
[9] KS2778..3139
[9] ACP3429..3498
[10] KS3516..3891
[10] KR4295..4477
[10] ACP4562..4631
[11] KS4698..5066
[11] KR5492..5693
[11] ACP5829..5898
[12] KS5928..6296
[7] DH415..876
[7] KR1693..2214
[7] ACP2461..2667
[8] KS2809..3912
[8] DH4534..5004
[8] KR6004..6549
[8] MT7297..7608
[8] ACP7942..8148
[9] KS8332..9417
[9] ACP10285..10494
[10] KS10546..11673
[10] KR12883..13431
[10] ACP13684..13893
[11] KS14092..15198
[11] KR16474..17079
[11] ACP17485..17694
[12] KS17782..18888

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [848-863]  PS00012 [5856-5871]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [814-953]  3.00000067992871e-18 SSF47336 [2645-2794]  5.79999653854781e-15 SSF47336 [3422-3532]  1.60000240695997e-19 SSF47336 [4555-4714]  2.19999900980708e-17 SSF47336 [5822-5944]  1.60000240695997e-21 SSF47336
SSF47336   ACP_like
 [821-889]  PS50075 [2648-2716]  PS50075 [3429-3498]  PS50075 [4562-4631]  PS50075 [5829-5898]  PS50075
PS50075   ACP_DOMAIN
 [824-887]  2.80000000000001e-12 PF00550 [2650-2715]  4.1e-08 PF00550 [3432-3497]  1.3e-09 PF00550 [4565-4630]  1.8e-11 PF00550 [5832-5897]  1.1e-15 PF00550
PF00550   PP-binding
 [821-893]  1.29999999999998e-77 G3DSA:1.10.1200.10 [2648-2720]  1.29999999999998e-77 G3DSA:1.10.1200.10 [3432-3522]  3.99999999999998e-71 G3DSA:1.10.1200.10 [4561-4635]  1.29999999999998e-77 G3DSA:1.10.1200.10 [5831-5903]  2.39999999999997e-76 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013217 Methyltransferase type 12 (Domain)
 [2433-2536]  2.9e-16 PF08242
PF08242   Methyltransf_12
IPR013968 Polyketide synthase, KR (Domain)
 [565-738]  3.2e-51 PF08659 [2002-2181]  2.50000000000001e-49 PF08659 [4295-4476]  2.59999999999998e-45 PF08659 [5494-5691]  1.09999999999999e-34 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [937-1179]  1.79999999999997e-83 PF00109 [2778-3016]  8.90000000000015e-78 PF00109 [3516-3764]  1.29999999999998e-85 PF00109 [4698-4940]  8.90000000000015e-85 PF00109 [5928-6171]  3.79999999999991e-75 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1188-1304]  7.69999999999997e-38 PF02801 [3024-3139]  2.1e-37 PF02801 [3772-3891]  2.4e-32 PF02801 [4948-5066]  7.69999999999997e-38 PF02801 [6179-6296]  1.09999999999999e-40 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [937-1190]  G3DSA:3.40.47.10 [1192-1356]  G3DSA:3.40.47.10 [2778-3027]  G3DSA:3.40.47.10 [3029-3191]  G3DSA:3.40.47.10 [3523-3774]  G3DSA:3.40.47.10 [3776-3952]  G3DSA:3.40.47.10 [4698-4951]  G3DSA:3.40.47.10 [4952-5123]  G3DSA:3.40.47.10 [5930-6183]  G3DSA:3.40.47.10 [6184-6348]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [929-1355]  2.1000026783403e-91 SSF53901 [2770-3191]  1.39999277195148e-87 SSF53901 [3508-3951]  5.29997329885557e-89 SSF53901 [4690-5065]  1.09999184471405e-87 SSF53901 [5920-6349]  4.99996518094122e-93 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [565-774]  7.79999999999999e-124 G3DSA:3.40.50.720 [2001-2189]  1e-113 G3DSA:3.40.50.720 [4293-4479]  7.79999999999999e-124 G3DSA:3.40.50.720 [5488-5724]  7.79999999999999e-124 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [3677-3693]  PS00606 [4853-4869]  PS00606 [6084-6100]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [822-892]  1.29999924468179e-18 SM00823 [2649-2719]  2.39999798157265e-13 SM00823 [3430-3501]  1.29999924468179e-11 SM00823 [4563-4634]  3.29999802154459e-12 SM00823 [5830-5901]  9.20000434662057e-16 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [139-292]  8.69999350765688e-09 SM00826 [1512-1668]  1.60000240695997e-18 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [939-1358]  SM00825 [2780-3191]  SM00825 [3518-3951]  SM00825 [4700-5124]  SM00825 [5930-6349]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [565-738]  2.30000440726534e-50 SM00822 [2002-2183]  2.19999900980707e-44 SM00822 [4295-4477]  5.20000089003336e-33 SM00822 [5492-5693]  7.40000780398343e-25 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit