close all open/close all

CDS information : Kirro_00260


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction68,042 / 74,902 / + [in whole cluster]
68,042 / 74,902 / + [in contig]
Location68042..74902 [in whole cluster]
68042..74902 [in contig]
TypeCDS
Length6,861 bp (2,286 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)putative polyketide synthase
Gene
Gene (GenBank)kirAV
EC number
Keyword
Note
Note (GenBank)
  • trans-AT polyketide synthase architecture
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

12
13
DH2..155
ACP286..357
KR555..727
KS808..1177
DH1447..1592
KR1878..2044
ACP2123..2197

close this sectionSequence

selected fasta
>polyketide synthase [putative polyketide synthase]
MDSLDGLTCTVVIRGSDPVLRDHRVHGTRILPGVSLLDIILRVVRARGADPGGVELRRVL
FRNPVAAGPDFDTELTLRFARDDGHFRVSVSGTRRPSGQSEPVLDCRLYPGLPFPHRRRD
LEALRATARRSVDMADLYTTVRATGIEHGEFMRALGTLHAGPDELLADLSLSAQAAEYAE
YFHLHPAALDSSTLLPTQFAEAVPGDGARPYIPMLIESVRAAGPLGSRTLVHAAPPRQAG
PDGDLTTCDLEFHAPDGTVIAWLHGLTSKRIRDAAAITRLEVRTPAAQDADRIVRDLIEA
RTGRADFDETAGFYELGLDSTALLGIAADLERVFGVDFSPTLLFEHNTFTLLAAHLRRYE
VVAAPPAEPVTAATAVTETTAGTPSTAETEVPAETVWFETSWQPATLPPGAPSAHWVTAG
AHTRADWPSALADTAAAAVLWQPADPADLTGEAVALSEFLAAAIRAGRSTLRLVCHVEDD
DAPVIALAGLLRTAVREHPGVRAAVVRSPRRADALAELAAGAPDVEVCYAHGTRRIRLAR
PMPAPADRASLRERGVYLITGGLGGVGLALARHLARSVHARLVLVGRTPADPSVTAELTA
LGAEVVTLVTDVTRADDVDRAVRTAVDRFGVLHGVVHAAGVLRDGLLAGKRADDVRAVLA
PKVDGARHLEAATRRLSLDFLVLCSSTAGTWGNPGQADYACANAFLDLFAGTRRDIVSVG
WPAWAEGGMQVDDAALRRMGLRSLQTPAAVDVLLAAVGSGRSHVVVLNGDAARITAEFTP
PEADHAARITAEFTPPEADPEPVGPDDDAIAVVGISGRYPMARDLDEFWANLRDGRDCVS
TVPADRWDHAAIYSEDRRTPGRSYGKWGGFLSGVDEFDAEFFHISPNEAAVLDPQERLFL
QEAWHAFEEAGHAPSAWRGRPVGVFAGVMYNQYQLYGVGPEPGPVPSSFSASIANRVSYF
LDLRGPSIALDSMCSSSLTALHLAVEAIRRGECEAALAGGVNLAVHPNKYLLLSQSSFLS
TDGRCRAFGEGGDGYVPGEGVGVVLLRPLRDALRDGDHVHAVIRGTAVNHGGRTAGFSVP
NPASQAALIAGSLRRAAVDPAHLGYLEAHGTGTSLGDPIEVAALEEAFDRIGAGPGPWPI
GSVKSNIGHLESAAGVAALTKVVLQLRHRELVPSLHADPLTSAVRWETARFRVQRERAPW
PGRADVPRTAAISSFGAGGANAHVVLAEWPAPPAVPEPAEPRLFVVSARDTARLDESVAR
LVTHLEGTGEDVAATVTALVTEVGATAARPDEPFAELGLDFPQLADLAHRVQEVFGTRPV
IDGETTADALAAALRTAAVAVDPAALAYTLWSGREHLDERLAVVATTTAELLTALRTGVG
CHRGRRRKPAAAVTGDDLDALAAAWVTGAEITPPMPARARRLSLPGYPFARDRHWVTTGT
DPGRVRADLMELPGGHVLPARISRDGHGWLADHAVDGTTLVPGTFFADLALRAGARLGRP
VVAELVIEAPLPFGDTDLRLTAALPGDDGRCAFEVHARAAGEPGWTRHATGALAPAGGAV
TGPPPLPGDAEELDLTGLYDRLPGYGPAFQGLRRAWRAGDTVYADVTVPGGDAGPYAVHP
VLLDAALHTVALGGFVPDGRVHLPFAWSGIRAAASGAVAARACVAPVRPGVVSVRLTDAA
GGPVASVDAVTLRPAGASADPLYRVDWVPLDDVRPGSPGRYAVVGPDRDGVGAALTAAGV
TVTRADTAAALTGPAEVVIVPVAATGTSASAAFELTRDVLEQARHWLGESRFGDAHLVFV
TMDPGPATAAAWGLLRSAQSEHPGRFSLVELSGADAVEVLPHALATGEPQLTVRDGRVLA
ARLVRAPATDAPPPRRPGTLLVTGGSGGLAGPVVRHLVARHGFTDVLLVSRSGRVPTGLR
DLSARIEPVACDVGDRDALAALLADRTISMVVHAAGVLDDGVVTALDADRLETVWRAKAA
GAHHLHELLPEAELVLFSSAAGVLGGPGQGNYAAANAYLDALARHRVAAGGRAVSVAWGP
WDLDDGMTADRERLARAGLAGLTVEAGLRLLDAALAGTEPEVVALRLAPGTPAAVPPVLR
GLLSAAPAVVSDAGLAGLGSAELRARLSGLVRGEAAAVLGYAGAAAIDPGRSFQELGFDS
LSSVEFRNRLGAALGLTLEATLVFDHPTPADLVEHLAGRFDGGTGGADDLPALFADFDRL
AAGLTEAATDEVFRDRVVERVRGLLTALSPATPEAPPDLFAAATDDEVFALIDAELGSPV
RGQEDR
selected fasta
>polyketide synthase [putative polyketide synthase]
ATGGACTCCTTGGACGGGCTGACCTGCACCGTCGTGATCCGGGGCAGCGACCCGGTGCTG
CGCGACCACCGTGTCCACGGCACCCGGATCCTGCCCGGGGTGTCGCTGCTCGACATCATC
CTGCGGGTGGTGCGAGCCCGGGGGGCGGATCCCGGCGGTGTCGAGCTGCGCCGTGTGCTG
TTCCGCAACCCCGTCGCCGCCGGGCCGGACTTCGACACCGAGCTGACGCTGCGCTTCGCC
CGCGACGACGGGCACTTCCGGGTGTCGGTCAGCGGCACCCGCCGCCCCTCGGGGCAGAGC
GAACCGGTCCTGGACTGCCGGCTGTACCCGGGCCTGCCGTTCCCGCACCGCCGGCGGGAC
CTGGAGGCCCTGCGCGCCACCGCACGGCGGAGCGTCGACATGGCCGACCTGTACACGACC
GTCCGCGCCACCGGTATCGAGCACGGCGAGTTCATGCGGGCCCTCGGCACCCTGCACGCC
GGACCGGACGAACTGCTCGCGGACCTCTCGCTGAGCGCCCAGGCCGCCGAGTACGCCGAG
TACTTCCACCTCCATCCGGCGGCGCTGGACTCCTCGACGCTGCTGCCCACCCAGTTCGCC
GAGGCCGTGCCGGGCGACGGGGCACGCCCGTACATCCCGATGCTGATCGAATCGGTGCGG
GCCGCGGGACCGCTGGGCTCGCGGACCCTGGTGCACGCCGCCCCGCCGCGCCAGGCCGGG
CCCGACGGCGATCTGACCACGTGTGACCTGGAGTTCCACGCCCCGGACGGAACCGTCATC
GCCTGGCTGCACGGCCTGACCTCCAAACGGATCCGGGACGCCGCGGCGATCACCCGCCTC
GAGGTACGCACCCCGGCGGCGCAGGACGCCGACCGGATCGTCCGGGACCTGATCGAGGCG
AGGACCGGCCGCGCCGACTTCGACGAGACGGCCGGGTTCTACGAGCTCGGCCTCGACTCG
ACGGCGCTGCTGGGGATCGCTGCCGACCTGGAACGGGTCTTCGGCGTCGACTTCTCCCCG
ACCCTGCTGTTCGAGCACAACACGTTCACCCTGCTGGCCGCACACCTGCGACGGTACGAG
GTCGTGGCGGCCCCGCCGGCGGAACCGGTGACCGCGGCGACCGCCGTGACGGAGACGACC
GCCGGGACCCCGTCGACCGCCGAGACCGAGGTACCCGCCGAGACGGTGTGGTTCGAGACG
TCCTGGCAGCCGGCCACGCTGCCGCCCGGAGCCCCCTCGGCGCACTGGGTCACGGCCGGT
GCGCACACCCGGGCGGACTGGCCGTCCGCGCTCGCGGACACCGCCGCGGCCGCTGTGCTG
TGGCAGCCCGCCGATCCTGCCGACCTCACCGGTGAAGCGGTCGCGCTGAGCGAGTTCCTG
GCGGCCGCGATCCGCGCGGGACGCAGCACCCTGCGGCTGGTCTGCCACGTCGAGGACGAC
GACGCGCCGGTGATCGCTCTCGCCGGTCTGCTCCGCACCGCGGTGCGGGAGCACCCGGGC
GTTCGGGCCGCGGTGGTCCGTTCGCCACGCCGGGCCGACGCGCTGGCCGAGCTGGCCGCC
GGGGCCCCCGACGTGGAGGTGTGCTACGCGCACGGCACCCGCCGGATCCGGCTCGCCCGG
CCCATGCCGGCACCGGCGGACAGGGCGTCGCTGCGAGAGCGCGGGGTCTACCTGATCACC
GGAGGGCTCGGCGGGGTCGGGCTGGCCCTGGCCCGGCACCTGGCCCGGTCGGTACACGCC
CGGCTCGTCCTGGTCGGCCGCACCCCGGCCGATCCGTCCGTCACCGCCGAGCTGACAGCC
CTCGGCGCCGAGGTGGTCACCCTGGTGACGGACGTGACCCGTGCGGACGACGTCGACCGG
GCGGTGCGCACCGCGGTGGACCGCTTCGGCGTGCTGCACGGGGTGGTGCACGCCGCCGGC
GTGCTGCGTGACGGATTGCTGGCGGGGAAGCGCGCCGATGACGTTCGGGCCGTGCTCGCC
CCCAAGGTCGACGGTGCCCGGCACCTCGAAGCGGCCACCCGGCGCCTGAGTCTGGACTTC
CTGGTGCTCTGCTCGTCGACCGCCGGCACCTGGGGCAATCCGGGGCAGGCCGACTACGCG
TGCGCGAACGCGTTCCTGGACCTGTTCGCCGGCACCCGCCGCGACATCGTGTCGGTGGGC
TGGCCGGCCTGGGCGGAAGGCGGCATGCAGGTCGATGACGCCGCGCTGCGCCGGATGGGC
CTGCGAAGCCTGCAGACCCCGGCCGCCGTCGACGTGCTGCTGGCGGCCGTGGGCAGCGGC
CGTTCCCACGTCGTGGTCCTGAACGGGGACGCGGCCCGGATCACGGCCGAGTTCACCCCG
CCGGAGGCGGACCACGCGGCCCGGATCACGGCCGAGTTCACCCCGCCGGAGGCGGACCCC
GAGCCGGTCGGACCCGACGACGACGCGATCGCCGTGGTGGGCATCAGCGGCCGCTACCCG
ATGGCCCGCGACCTCGACGAGTTCTGGGCGAACCTGCGCGACGGCCGTGACTGCGTCAGC
ACGGTGCCCGCCGATCGATGGGATCACGCGGCGATCTACTCCGAAGACCGCCGGACGCCC
GGACGCTCCTACGGCAAATGGGGTGGCTTCCTCTCGGGGGTGGACGAGTTCGACGCGGAG
TTCTTCCACATCTCGCCGAACGAGGCGGCCGTGCTGGACCCGCAGGAGCGGCTGTTCCTG
CAGGAGGCGTGGCACGCGTTCGAGGAGGCCGGGCACGCGCCGTCGGCCTGGCGCGGCCGG
CCCGTCGGGGTGTTCGCCGGGGTGATGTACAACCAGTACCAGCTCTACGGCGTCGGCCCG
GAGCCGGGCCCGGTGCCCTCGTCGTTCAGCGCGTCCATCGCCAACCGGGTGTCGTACTTC
CTGGACCTGCGCGGACCGAGCATCGCCCTGGACAGCATGTGCTCGTCCTCGCTGACCGCG
CTGCACCTGGCCGTCGAGGCCATCCGCCGGGGGGAGTGCGAGGCGGCCCTGGCCGGTGGC
GTCAACCTGGCCGTGCACCCGAACAAGTACCTGCTGCTGAGCCAGTCCTCCTTCCTGTCC
ACCGACGGGCGTTGCCGCGCCTTCGGTGAGGGCGGGGACGGCTACGTGCCCGGCGAGGGA
GTCGGCGTGGTGCTGCTGCGCCCGCTGCGCGACGCGCTGCGCGACGGCGACCACGTCCAC
GCCGTCATCCGCGGTACCGCGGTCAACCACGGCGGCCGCACCGCCGGGTTCTCCGTGCCG
AACCCGGCATCGCAGGCCGCCCTGATCGCAGGGTCGCTGCGCCGGGCCGCGGTCGACCCC
GCCCACCTCGGCTACCTGGAGGCGCACGGCACCGGCACCAGCCTCGGCGACCCGATCGAG
GTCGCCGCGCTGGAGGAGGCCTTCGACCGGATCGGCGCCGGCCCGGGTCCCTGGCCGATC
GGATCGGTCAAGTCGAACATCGGGCACCTGGAGTCCGCGGCCGGCGTCGCGGCGCTCACC
AAGGTCGTACTTCAACTGCGCCATCGGGAACTCGTGCCGTCGTTGCACGCCGACCCGCTG
ACCAGCGCGGTGCGGTGGGAGACCGCACGGTTCCGGGTACAGCGCGAACGGGCGCCGTGG
CCGGGACGCGCGGACGTGCCGCGGACCGCGGCGATCAGCTCCTTCGGTGCGGGCGGGGCC
AACGCGCACGTCGTCCTCGCCGAGTGGCCGGCGCCGCCGGCCGTGCCGGAACCGGCCGAG
CCGCGGCTGTTCGTGGTGTCCGCCCGGGACACCGCCCGCCTCGACGAGAGCGTGGCCCGG
CTGGTGACCCACCTGGAGGGCACCGGCGAGGACGTGGCCGCGACCGTGACCGCGCTGGTG
ACCGAGGTCGGTGCGACCGCGGCACGGCCCGACGAGCCGTTCGCCGAACTGGGCCTGGAC
TTCCCGCAACTGGCCGACCTCGCCCACCGCGTCCAGGAGGTGTTCGGGACCCGCCCCGTG
ATCGACGGAGAGACCACCGCCGATGCCCTGGCCGCCGCCCTGCGCACGGCGGCCGTCGCG
GTGGACCCGGCGGCGCTGGCGTACACGTTGTGGTCCGGGCGTGAGCACCTGGACGAGCGG
CTCGCCGTCGTGGCCACGACCACCGCCGAACTGCTGACGGCGTTGCGCACCGGGGTCGGC
TGCCATCGCGGCCGCCGGCGGAAACCGGCCGCGGCGGTGACCGGTGACGACCTCGACGCG
CTCGCCGCCGCCTGGGTCACCGGGGCCGAGATCACCCCGCCGATGCCGGCGCGAGCACGC
CGACTGTCGCTGCCCGGATACCCGTTCGCCCGGGACCGGCACTGGGTGACCACCGGCACG
GACCCGGGCCGGGTGCGGGCCGACCTGATGGAACTGCCCGGCGGGCATGTGCTGCCGGCC
AGGATCTCGCGGGACGGCCACGGCTGGCTGGCCGACCACGCCGTCGACGGGACCACGCTG
GTGCCCGGGACGTTCTTCGCCGACCTGGCCCTGCGGGCCGGCGCCCGGCTCGGCCGGCCG
GTCGTGGCCGAGCTGGTGATCGAGGCGCCGCTGCCGTTCGGCGACACCGACCTGCGGCTC
ACCGCGGCCCTGCCCGGTGACGACGGGCGATGCGCCTTCGAGGTGCACGCCCGCGCTGCC
GGAGAACCGGGCTGGACCCGGCACGCGACCGGAGCACTCGCCCCCGCCGGTGGCGCCGTG
ACCGGACCGCCCCCGCTGCCCGGCGACGCCGAGGAGCTCGACCTCACCGGCCTCTACGAC
CGGTTGCCCGGCTACGGTCCCGCGTTCCAGGGGCTGCGCCGCGCCTGGCGGGCCGGCGAC
ACCGTGTACGCCGACGTCACCGTGCCCGGCGGTGACGCCGGCCCGTACGCCGTGCACCCC
GTTCTCCTGGACGCGGCGCTGCACACGGTGGCGCTCGGCGGATTCGTCCCGGACGGCCGG
GTTCACCTGCCGTTCGCCTGGTCCGGGATCCGGGCCGCGGCGAGCGGCGCGGTCGCCGCG
CGGGCCTGCGTCGCCCCGGTCCGCCCCGGTGTCGTGTCCGTGCGGCTCACCGATGCCGCC
GGCGGGCCGGTGGCCTCGGTGGACGCGGTGACCCTGCGCCCCGCCGGAGCCTCGGCAGAC
CCCCTGTACCGCGTCGACTGGGTGCCCCTCGACGACGTCCGTCCCGGCTCACCCGGCCGG
TACGCCGTCGTGGGCCCCGACCGGGACGGCGTCGGCGCCGCGCTCACCGCCGCGGGCGTG
ACCGTGACCCGCGCGGACACCGCGGCGGCGCTGACCGGACCCGCCGAGGTGGTGATCGTG
CCGGTCGCCGCGACGGGGACGTCGGCGTCCGCCGCGTTCGAGCTGACCCGTGACGTCCTT
GAACAGGCGCGGCACTGGCTCGGCGAGAGCCGCTTCGGCGACGCCCACCTGGTCTTCGTC
ACCATGGACCCGGGCCCGGCCACGGCCGCCGCATGGGGACTGCTGCGCTCGGCGCAGTCC
GAGCACCCCGGCCGCTTCTCACTCGTCGAGCTGTCCGGGGCGGACGCGGTGGAGGTCCTG
CCGCATGCCCTGGCCACCGGCGAGCCGCAGCTGACCGTCCGCGACGGGCGGGTGCTGGCG
GCCCGCCTCGTACGCGCCCCGGCCACCGACGCGCCGCCCCCGCGCCGGCCGGGCACGCTG
CTCGTCACCGGGGGCAGCGGTGGCCTCGCCGGCCCGGTGGTGCGTCACCTGGTCGCCCGG
CACGGATTCACCGACGTGCTCCTGGTCAGCCGCAGTGGCCGCGTCCCCACCGGGCTCCGC
GATCTGAGCGCGCGGATCGAGCCGGTCGCCTGCGACGTCGGTGACCGGGATGCGCTGGCC
GCGCTGCTCGCCGACCGGACGATCAGCATGGTGGTGCACGCCGCCGGGGTGCTCGACGAC
GGTGTGGTGACCGCGCTGGACGCCGACCGGCTGGAGACCGTGTGGCGGGCCAAGGCCGCC
GGCGCCCACCACCTGCACGAGCTGTTGCCCGAGGCCGAGCTGGTGCTCTTCTCCTCGGCG
GCCGGTGTGCTCGGCGGGCCCGGCCAGGGCAACTACGCCGCGGCCAACGCCTATCTCGAC
GCGCTGGCCCGGCACCGGGTCGCGGCGGGCGGCCGAGCGGTCTCGGTGGCCTGGGGGCCA
TGGGACCTCGACGACGGCATGACCGCCGACCGCGAACGGCTGGCCCGCGCCGGCCTCGCC
GGGCTGACGGTCGAGGCGGGACTGCGCCTGCTGGACGCCGCGCTGGCCGGTACGGAGCCC
GAGGTGGTCGCGCTGCGGTTGGCCCCGGGCACCCCCGCGGCCGTACCCCCCGTACTGCGC
GGCCTGCTGAGTGCCGCACCGGCCGTCGTATCCGACGCGGGCCTGGCCGGGCTGGGATCC
GCGGAGCTGCGCGCCAGGCTGTCGGGCCTGGTCCGCGGCGAGGCCGCGGCCGTGCTCGGC
TACGCCGGTGCCGCCGCGATCGATCCGGGGCGCTCCTTCCAGGAGCTGGGGTTCGACTCG
CTGAGCTCGGTGGAGTTCCGCAACCGCCTCGGCGCGGCGCTCGGCCTGACGCTGGAGGCG
ACCCTCGTCTTCGACCATCCCACCCCCGCTGATCTGGTGGAGCACCTCGCCGGGCGGTTC
GACGGCGGCACCGGCGGTGCCGACGACCTGCCGGCGCTGTTCGCCGACTTCGACCGCCTG
GCCGCCGGTCTGACCGAGGCGGCCACCGACGAGGTGTTCCGCGACCGGGTGGTCGAACGG
GTGCGTGGGCTGCTCACCGCCCTGAGCCCGGCGACGCCCGAGGCACCGCCGGACCTGTTC
GCCGCCGCAACCGACGACGAGGTGTTCGCCCTGATCGACGCCGAGCTGGGCAGCCCCGTA
CGGGGTCAGGAGGACCGATGA
[12] DH2..155
[12] ACP286..357
[12] KR555..727
[13] KS808..1177
[13] DH1447..1592
[13] KR1878..2044
[13] ACP2123..2197
[12] DH4..465
[12] ACP856..1071
[12] KR1663..2181
[13] KS2422..3531
[13] DH4339..4776
[13] KR5632..6132
[13] ACP6367..6591

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [315-330]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [294-356]  2e-10 PF00550 [2131-2196]  1.3e-12 PF00550
PF00550   PP-binding
 [286-357]  PS50075 [2123-2197]  PS50075
PS50075   ACP_DOMAIN
 [283-394]  1.09999909120787e-12 SSF47336 [2118-2204]  5.39999384454126e-21 SSF47336
SSF47336   ACP_like
 [287-358]  8.10000000000001e-31 G3DSA:1.10.1200.10 [2128-2199]  1.6e-35 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [555-726]  5.49999999999995e-56 PF08659 [1878-2042]  3.60000000000002e-45 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [808-1052]  2.90000000000003e-84 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [1060-1177]  2.29999999999998e-37 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [808-1063]  6.99999999999989e-87 G3DSA:3.40.47.10 [1064-1231]  8.70000000000003e-55 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [807-1231]  1.19999063421924e-89 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [554-758]  5.69999999999998e-62 G3DSA:3.40.50.720 [1878-2051]  1.9e-68 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [291-360]  1.49999977583352e-08 SM00823 [2128-2200]  2.10000267834031e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [2-155]  1.60000065022528e-06 SM00826 [1447-1592]  2.80000504261099e-39 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [810-1231]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [555-727]  1.79999754022375e-52 SM00822 [1878-2044]  1.10000150671643e-36 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit