close all open/close all

CDS information : Kirro_00280


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction83,835 / 84,683 / + [in whole cluster]
83,835 / 84,683 / + [in contig]
Location83835..84683 [in whole cluster]
83835..84683 [in contig]
TypeCDS
Length849 bp (282 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)kirHI
EC number
Keyword
  • pyridone moiety
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)
Related Reference
ACC
F1DI35
PmId
[25621700] Discovery of a new family of Dieckmann cyclases essential to tetramic acid and pyridone-based natural products biosynthesis. (Org Lett. , 2015)

close this sectionSequence

selected fasta
>cyclase [hypothetical protein]
MPSPSVWNVVLDAASDADVVLATDFPVTGRNEGGFADLTPSLGLDCALWQTVAPARAPGP
GIDPDEYLAPWLAEVAASGRRVRAVLGYCAGSVFAGALAERIADRQPVAPQVVVFDPELV
DVPTVHLQFGRVIGNMTAVLTPAEVDELAGAAERLAARPGITPAAFATELYAIFEPIGSA
ALRRAGLDEGYAGELVALVGSFMTYLGVAAGLDPRPGWSRATVVTSASPASGLNRMRATP
GLAPIAVADEVRFEVEHRDLLRTPEVATTVAGLLGTGSQARR
selected fasta
>cyclase [hypothetical protein]
ATGCCAAGCCCTTCCGTGTGGAATGTGGTGCTCGACGCAGCATCGGACGCCGACGTCGTG
CTCGCCACCGACTTCCCGGTGACGGGCCGCAACGAGGGCGGTTTCGCCGACCTGACGCCC
AGCCTGGGACTGGACTGCGCGCTGTGGCAGACCGTCGCACCGGCCCGGGCCCCCGGCCCC
GGCATCGACCCGGACGAGTACCTCGCGCCCTGGCTGGCCGAGGTCGCCGCGAGCGGACGC
AGGGTCCGGGCGGTCCTCGGCTACTGCGCCGGATCGGTCTTCGCCGGCGCCCTGGCCGAG
AGGATCGCCGACCGCCAGCCGGTCGCCCCGCAGGTGGTGGTCTTCGACCCCGAACTCGTC
GACGTGCCCACCGTGCACCTGCAGTTCGGCCGGGTCATCGGCAACATGACCGCCGTACTG
ACCCCGGCCGAGGTCGACGAGCTGGCCGGCGCCGCGGAGCGCCTGGCCGCCCGGCCCGGG
ATCACCCCGGCCGCGTTCGCCACCGAGCTCTATGCGATCTTCGAGCCGATCGGCTCGGCC
GCGCTGCGCCGCGCCGGCCTCGACGAGGGCTACGCCGGTGAACTGGTGGCCCTGGTCGGC
TCGTTCATGACCTATCTCGGCGTCGCCGCCGGACTCGATCCGCGTCCCGGCTGGTCCCGG
GCCACCGTCGTCACCTCGGCGAGCCCGGCCAGCGGACTCAACCGGATGCGCGCCACCCCC
GGCCTGGCACCGATCGCCGTGGCGGACGAGGTCCGGTTCGAGGTGGAGCACCGCGATCTG
CTGCGCACCCCGGAGGTCGCCACGACCGTGGCCGGCCTGCTCGGCACCGGCTCGCAGGCC
CGCCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-22]  0.256 Signal
Bacteria, Gram-positive   
 [1-22]  0.242 Signal
Eukaryota   
TMHMM No significant hit