close all open/close all

CDS information : Kirro_00290


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction84,680 / 87,781 / + [in whole cluster]
84,680 / 87,781 / + [in contig]
Location84680..87781 [in whole cluster]
84680..87781 [in contig]
TypeCDS
Length3,102 bp (1,033 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.2 NRPS
Productnon-ribosomal peptide synthetase
Product (GenBank)putative non-ribosomal peptide synthetase
Gene
Gene (GenBank)kirB
EC number
Keyword
  • beta-alanine
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionPKS/NRPS Module

16 beta-alanine
C18..286
A483..875
PCP963..1030

close this sectionSequence

selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase]
MTAGAADARGRASRKETALWLLDDLVPGSGANNLSLAFRVAGRLDPAALATALDLLPRRY
EVLRTVFHRSDDALTRTVLPSLRIEPEQADAHGDDHGAGHGDERDALTAFVARPFRADGS
PLLRALLLHGPDDDILCLALHHAIADVQSTAVLRAQLVEFYEAVLAGRTPEPDPVPAWHE
PAPSERSLTFWRDTMAGFRSSGSELWCEKPAPATTTLEGDEVTHVLSPEAHEVVRRLQRE
LRAPESVVLLTAYAVLLAGHGAGPDLTIGSPVNTRGREAAGAVGYHSNLVTLRLLTERTA
GFRELVGRARRVFMEAMTHADTPADELLDVVERDGSGWRNVLFRHVFNYVPFTAGQRTFT
VAGAAAELVVVENGFSQFDLEFFVTSDRDSATVRAAFYTGVLDRADVDLMVRRYDALLVA
VGAALDTPVGSLSIWSPRDHAVIDAANATDRPIELTSVLAGFAERAAAEPDALAVRDGDR
GVSYGRLWSAAAHTAERLTAAGVRPGDIVALLVPRGAALAAAVFGTWLAGAAYLPLDPHH
PAERIAYQLDDAGARVVVTGDGLTAPGDRRTVPAPDVDAAPTLPVDRDRTGAAGPDALAY
VIYTSGSTGRPKGIPITHRSLANHITDYAVRFGVAATARPTGWLSTYSFDTSSLELMMPL
LHGGHTVVLPDEARTDGALLAEAIRVHDIGFLQATPTTWRLVADRITALVAGRTLLSGGE
PLPGGLAATLTGAGAELWNVYGPTESTIWATAGRVPTDPGDRVDVGTPIANTRVFIAGPD
GEPLPIGLRGELCVAGVGVAAGYHGRPDLTAERFGSNPRWGRFYRSGDVARWLPDGRINL
LGRMDRQVKLRGNRIELGEIEAVLSDHPDVEAAAVLVVGDPGTDGSLAAFVQVPHRPEAM
GELWEYARQRLPRSVVPHRFLAVEAFPRTGSDKVDYLALADLAARRPAATGGDAAGPVGG
DALTATLTKLFAELLDQPDLDADSHFFTSGGHSLLAAALAQRIKDETGVRLPLTDVFENP
TPAALAGRLRGLG
selected fasta
>non-ribosomal peptide synthetase [putative non-ribosomal peptide synthetase]
ATGACGGCCGGCGCGGCGGACGCCCGCGGGCGCGCCTCGCGCAAGGAGACCGCTCTGTGG
CTGCTCGACGACCTCGTGCCCGGCAGCGGCGCCAACAACCTGTCGCTGGCCTTCCGCGTC
GCCGGCCGCCTCGACCCGGCCGCCCTGGCCACGGCACTCGACCTGCTGCCCCGCCGGTAC
GAGGTGCTGCGCACGGTCTTCCACCGCAGCGACGACGCCCTGACCAGGACCGTCCTGCCC
AGCCTCCGCATCGAGCCGGAGCAGGCGGACGCGCACGGTGACGACCACGGCGCCGGGCAC
GGTGACGAGCGCGACGCCCTGACCGCTTTCGTGGCCCGCCCCTTCCGGGCCGACGGGAGC
CCGCTGCTTCGCGCCCTGCTGCTGCACGGCCCCGACGACGACATCCTCTGTCTCGCGCTG
CACCACGCCATCGCCGACGTGCAGTCCACCGCCGTCCTGCGCGCCCAGCTCGTCGAGTTC
TACGAGGCGGTGCTGGCCGGCCGGACCCCCGAGCCGGACCCGGTGCCCGCCTGGCACGAG
CCCGCGCCCTCCGAACGGAGCCTCACGTTCTGGCGCGACACCATGGCCGGGTTCCGCTCG
TCCGGCTCGGAGCTGTGGTGCGAGAAGCCGGCCCCGGCGACCACCACGCTGGAGGGTGAC
GAGGTCACCCACGTCCTGTCGCCCGAGGCGCACGAGGTCGTCCGGCGGCTGCAACGCGAG
CTGCGCGCGCCCGAGTCGGTCGTCCTGCTCACCGCGTACGCGGTGCTGCTGGCCGGACAC
GGCGCCGGACCCGACCTGACCATCGGCTCGCCGGTCAACACGCGCGGCCGGGAAGCGGCC
GGGGCGGTCGGCTACCACAGCAACCTGGTCACGCTGCGCCTGCTGACCGAGCGCACGGCA
GGTTTCCGCGAGCTGGTCGGCCGGGCGCGCCGGGTCTTCATGGAGGCGATGACCCACGCG
GACACCCCCGCCGACGAACTGCTCGACGTGGTCGAGCGCGACGGTTCCGGCTGGCGCAAC
GTGCTGTTCCGGCACGTGTTCAACTACGTGCCGTTCACCGCCGGCCAGCGCACCTTCACG
GTGGCGGGCGCCGCGGCGGAACTGGTCGTGGTCGAGAACGGGTTCAGCCAGTTCGACCTG
GAATTCTTCGTGACCTCCGACCGTGACAGCGCAACCGTGCGCGCGGCGTTCTACACCGGG
GTCCTGGACCGCGCGGACGTCGACCTCATGGTCCGCCGCTACGACGCGCTGCTGGTCGCC
GTCGGCGCCGCCCTGGACACGCCGGTCGGCTCGCTGTCGATCTGGTCACCCCGGGACCAC
GCGGTCATCGACGCCGCCAACGCCACCGACCGCCCGATCGAGCTGACGTCGGTGCTCGCC
GGATTCGCCGAGCGCGCCGCCGCCGAGCCGGACGCCCTCGCGGTCCGCGACGGAGACCGT
GGAGTGAGCTACGGTCGCCTGTGGTCCGCCGCGGCGCACACCGCCGAGCGGCTGACGGCG
GCCGGCGTCCGCCCCGGCGACATCGTCGCGCTGCTCGTGCCGCGGGGTGCGGCACTGGCC
GCCGCGGTGTTCGGGACCTGGCTCGCCGGTGCGGCGTACCTGCCGCTGGACCCGCACCAC
CCGGCGGAGCGCATCGCCTACCAGCTGGACGACGCGGGCGCACGGGTGGTGGTGACCGGC
GACGGCCTCACCGCGCCCGGCGACCGCCGGACGGTCCCCGCCCCCGACGTCGACGCCGCG
CCCACCCTCCCCGTCGACCGCGACAGGACCGGCGCGGCAGGGCCGGACGCCCTCGCGTAC
GTGATCTACACCTCCGGATCGACGGGACGGCCCAAGGGCATCCCCATCACCCACCGGAGC
CTGGCCAACCACATCACCGACTACGCGGTGCGCTTCGGCGTCGCCGCGACGGCGCGGCCC
ACCGGCTGGCTCAGCACGTACAGTTTCGACACCTCGTCGCTGGAACTGATGATGCCGCTG
CTGCACGGCGGCCACACGGTCGTGCTGCCCGACGAGGCGCGCACCGACGGAGCCCTGCTG
GCCGAGGCGATACGCGTCCACGACATCGGATTCCTGCAGGCGACGCCGACCACCTGGCGA
CTCGTCGCCGACCGGATCACCGCTCTGGTCGCAGGCCGCACGCTGCTCAGCGGAGGTGAG
CCACTGCCCGGCGGCCTGGCCGCGACCCTGACCGGGGCGGGCGCCGAACTGTGGAACGTC
TACGGCCCCACGGAGAGCACGATCTGGGCGACCGCAGGACGGGTGCCGACGGACCCCGGC
GACCGGGTCGACGTGGGGACGCCGATCGCCAACACCCGGGTCTTCATCGCCGGCCCGGAC
GGGGAGCCGCTGCCGATCGGCCTGCGCGGCGAATTGTGCGTCGCCGGGGTCGGTGTCGCC
GCCGGCTACCACGGGCGGCCCGACCTCACCGCCGAGCGGTTCGGATCGAACCCCCGGTGG
GGACGCTTCTACCGCTCCGGAGACGTGGCGCGCTGGCTGCCGGACGGCCGCATCAACCTG
CTGGGCCGCATGGACCGGCAGGTGAAGCTGCGCGGCAACCGGATCGAACTGGGCGAGATC
GAGGCGGTGTTGTCCGATCACCCGGACGTCGAGGCGGCCGCCGTGCTGGTGGTCGGCGAC
CCCGGCACGGACGGCAGCCTGGCCGCTTTCGTCCAGGTGCCGCACCGGCCCGAGGCGATG
GGCGAGCTCTGGGAGTACGCCCGGCAGCGGCTGCCGCGCTCGGTGGTGCCGCACCGCTTC
CTCGCGGTGGAGGCGTTTCCGCGTACCGGAAGCGACAAGGTCGACTACCTGGCGCTGGCG
GACCTCGCCGCGCGCAGGCCGGCCGCGACCGGCGGTGACGCCGCGGGCCCGGTCGGCGGC
GACGCGCTCACCGCCACCCTGACCAAGCTCTTCGCCGAGCTGCTCGACCAGCCGGACCTG
GACGCCGACTCCCACTTCTTCACCAGCGGTGGCCACTCGCTGCTCGCCGCCGCCCTCGCC
CAGCGCATCAAGGACGAGACAGGTGTCCGGCTGCCACTCACCGACGTGTTCGAGAACCCG
ACCCCCGCCGCGCTGGCCGGCCGCCTGCGCGGGCTCGGGTGA
[16] C18..286
[16] A483..875
[16] beta-alanine650..749
[16] PCP963..1030
[16] C52..858
[16] A1447..2625
[16] beta-alanine1948..2247
[16] PCP2887..3090

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [483-875]  1.29999999999998e-103 PF00501
PF00501   AMP-binding
IPR001242 Condensation domain (Domain)
 [18-286]  1.69999999999999e-29 PF00668
PF00668   Condensation
IPR006162 Phosphopantetheine attachment site (PTM)
 [988-1003]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [966-1028]  7.20000000000001e-14 PF00550
PF00550   PP-binding
 [963-1030]  PS50075
PS50075   ACP_DOMAIN
 [961-1031]  8.1e-21 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [956-1031]  1.09999909120787e-16 SSF47336
SSF47336   ACP_like
IPR010071 Amino acid adenylation domain (Domain)
 [483-875]  4.2e-115 TIGR01733
TIGR01733   AA-adenyl-dom
IPR020845 AMP-binding, conserved site (Conserved_site)
 [601-612]  PS00455
PS00455   AMP_BINDING
SignalP
 [1-31]  0.22 Signal
Eukaryota   
TMHMM No significant hit