close all open/close all

CDS information : Kirro_00300


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction87,805 / 91,041 / + [in whole cluster]
87,805 / 91,041 / + [in contig]
Location87805..91041 [in whole cluster]
87805..91041 [in contig]
TypeCDS
Length3,237 bp (1,078 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Producttrans-acting acyltransferase
Product (GenBank)putative acyltransferase
Gene
Gene (GenBank)kirCI
EC number
Keyword
  • trans AT
  • malonyl-CoA
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[23828654] The AT2 Domain of KirCI Loads Malonyl Extender Units to the ACPs of the Kirromycin PKS. (Chembiochem. , 2013)

close this sectionPKS/NRPS Module

17 malonyl-CoA
at5..305
AT347..601
er660..944

close this sectionSequence

selected fasta
>trans-acting acyltransferase [putative acyltransferase]
MLKPVFLFAGQGSQYHGMGRWLYGADPFFRDALDSLDAVVREINGDSVIDAIHGDGRGAE
LAMTRLSLTQPAIFMVEYALARMLRAHGFEPELVLGASLGEVVAAAVAGIFDPEECLRSL
LEQVALFEAECPRGGMLAVLADAGLVDREPALAGAHLAAINGPDNFVLAGTAGRLDAIER
HLAASGVLCQRLPVLFPFHSPLIDGVRDAFTKLVGGLTPRAASIPLISGTTGAEVRHPGP
DHFWQVLREPFDLSRALEPLLARDDLLFLDLGPSGSMANLVRARLPEGSRSRVLPLLSPY
ARDEVLYQAVLDTRSVIAAPARRTEVTTMTAPTPVADPATPGDGFDVYVFPGQGAQVKGM
GRDLFDRFPELVERADAVLGYSIRELCLEDPGRNLRDTRYTQPALYVVGALSWLATVQEG
GRLPDYLLGHSLGEFAALFAAGVYDFETGLRLVAERGRLMGQVTGGTMAAVSAVDSSLVR
EVLRDDELSGLDIANYNAPTQTVVAGPADAVNRALAVFKDKGARCAPLNVSAPFHSRYMA
QAAEEFGRLLDATAFAAPKIPVISNVDARPYEPDAVAATLRRQIVSPVRWTDSIRLLMGR
GDFRVRELGPGQVLTKLIARIRDEATPLRPEPARTTVPTGPVNAPAPRRAELGSAAFRRD
HGVRHAYVAGGMHHGVSSVALVARLARSGLLGHFGAAGLPLADVADAIRGIRAAAGADAP
FGVNITYDPFDPRAEADMVDLLVRENVRLVEAATYVEVTPALVRHRLTGARILADGTVHA
PRKLLAKVTRLDTARLFFAPPPRPLVTRLVDDGLLNAEEAAAGERIALADDICAIGDGAD
YTDQGSLPALLPSVRRLRTQLGGVASGVRVGGGGGIGSPESAAAAFVLGADFILTGSINL
CTAESGLSEAAKDLLPNLDVHDTAYAPHGALFELGGRARVLRKGVLFHVRAGKLYDLWRT
YDSWDAVPGWIRSRVERDYFGAGFEELASRVVPAGEPADPKRRMALVFRWYCAQAQRWAI
EGTPERVADYQVACGPALGACNHWLRGTTYEAWRDRHADELADRLITEAAEIVGSAGV
selected fasta
>trans-acting acyltransferase [putative acyltransferase]
ATGCTGAAACCGGTCTTCCTCTTCGCCGGGCAGGGCTCCCAGTACCACGGCATGGGCCGG
TGGCTCTACGGTGCCGACCCGTTCTTCCGCGACGCTCTGGATTCTCTGGACGCGGTGGTG
CGCGAGATCAACGGCGACTCGGTCATCGACGCGATCCACGGCGACGGCCGCGGCGCCGAG
CTGGCGATGACCCGCCTGTCGCTCACCCAGCCGGCCATCTTCATGGTCGAGTACGCTCTG
GCCCGCATGCTGCGCGCCCACGGCTTCGAGCCGGAGCTGGTGCTCGGCGCCAGCCTGGGC
GAGGTCGTCGCCGCCGCGGTGGCCGGCATCTTCGACCCCGAGGAATGTCTGCGCTCGCTG
CTGGAGCAGGTGGCGCTCTTCGAGGCTGAGTGCCCGCGCGGCGGGATGCTGGCGGTCCTC
GCCGACGCCGGCCTCGTCGACCGCGAACCCGCGCTGGCCGGGGCGCATCTGGCCGCGATC
AACGGGCCGGACAACTTCGTGCTCGCGGGCACGGCCGGCCGGCTCGACGCCATCGAGCGC
CACTTGGCCGCCTCGGGTGTGCTCTGCCAACGGCTCCCGGTGTTGTTCCCGTTCCACTCG
CCGCTGATCGACGGCGTGCGCGACGCCTTCACGAAGCTCGTGGGCGGTCTCACGCCCCGA
GCCGCGTCGATCCCGCTGATCTCCGGAACCACCGGTGCCGAGGTGCGCCACCCCGGCCCG
GACCACTTCTGGCAGGTCCTCCGTGAGCCGTTCGACCTGTCACGCGCCCTCGAACCGCTG
CTGGCCCGCGACGACCTGCTCTTCCTGGACCTCGGACCGTCCGGGTCGATGGCCAACCTG
GTACGGGCGCGGCTTCCCGAGGGCAGCCGGTCCCGGGTGCTGCCGCTGCTCTCCCCGTAC
GCCCGGGACGAGGTGCTGTACCAGGCGGTGCTCGACACCCGCTCGGTCATCGCCGCCCCG
GCTCGACGAACCGAGGTGACCACCATGACCGCTCCGACGCCCGTGGCCGACCCCGCCACC
CCGGGCGACGGCTTCGACGTCTACGTCTTCCCGGGTCAGGGCGCTCAGGTCAAGGGCATG
GGCCGAGACCTGTTCGACCGGTTCCCCGAACTGGTCGAACGGGCCGACGCCGTCCTCGGG
TACTCGATCCGTGAACTGTGCCTTGAGGACCCCGGCCGCAACCTGCGCGACACCCGGTAC
ACCCAGCCGGCCCTGTACGTGGTCGGCGCGCTCTCCTGGCTGGCCACCGTACAGGAGGGC
GGCCGTCTGCCCGACTACCTGCTCGGGCACAGCCTCGGTGAGTTCGCCGCCCTGTTCGCC
GCGGGCGTGTACGACTTCGAAACCGGCCTGCGCCTGGTCGCCGAACGCGGCCGGCTGATG
GGACAGGTCACCGGCGGCACCATGGCCGCGGTCTCGGCCGTCGACTCGTCCCTGGTCCGG
GAGGTGCTGCGCGACGACGAGCTGTCCGGACTGGACATCGCCAACTACAACGCGCCGACC
CAGACGGTCGTCGCCGGCCCGGCCGACGCGGTCAACCGCGCGCTTGCGGTGTTCAAGGAC
AAGGGCGCCCGCTGTGCCCCGCTCAACGTCAGCGCCCCCTTCCACAGCCGCTACATGGCG
CAGGCCGCGGAGGAGTTCGGGCGCCTGCTGGACGCCACCGCCTTCGCCGCCCCGAAGATC
CCGGTGATCAGCAACGTCGACGCCCGGCCGTACGAGCCGGACGCCGTGGCCGCCACCCTG
CGCCGCCAGATCGTCTCCCCGGTGCGGTGGACCGACAGCATCCGGCTGCTCATGGGCCGG
GGCGACTTCCGGGTCCGCGAACTGGGCCCGGGACAGGTGCTGACCAAGCTGATCGCCCGG
ATCCGGGACGAGGCCACCCCACTGCGGCCCGAACCGGCACGGACCACGGTGCCGACCGGG
CCGGTCAACGCTCCGGCACCGCGGCGCGCGGAGCTGGGCTCGGCGGCGTTCCGGCGCGAC
CACGGGGTCCGGCACGCCTACGTCGCCGGCGGCATGCACCACGGCGTCAGCTCCGTCGCC
CTGGTCGCCCGGCTGGCCCGCTCCGGCCTGCTCGGCCACTTCGGGGCGGCCGGGCTCCCG
CTCGCGGACGTCGCCGACGCGATCCGCGGCATCCGGGCGGCCGCCGGGGCCGACGCGCCG
TTCGGGGTCAACATCACCTACGACCCCTTCGACCCGCGCGCCGAGGCCGACATGGTCGAC
CTGCTGGTCCGTGAGAACGTCCGTCTCGTCGAGGCGGCCACGTACGTCGAGGTGACCCCC
GCACTGGTGAGGCACCGTCTGACCGGTGCCCGCATCCTGGCGGACGGAACGGTGCACGCC
CCGCGCAAGCTGCTCGCCAAGGTGACCCGCCTGGACACCGCCCGCCTGTTCTTCGCACCA
CCGCCGCGCCCCCTCGTGACACGGCTGGTGGACGACGGACTGCTCAATGCCGAGGAGGCC
GCGGCCGGCGAGCGGATCGCCCTGGCCGACGACATCTGCGCGATCGGCGACGGAGCCGAC
TACACCGACCAGGGCTCCCTGCCCGCGCTGCTGCCCTCGGTGCGACGGCTGCGCACACAG
CTCGGCGGGGTCGCCTCCGGCGTACGCGTCGGGGGCGGTGGAGGCATCGGCTCCCCGGAG
TCGGCCGCCGCCGCGTTCGTCCTGGGCGCCGACTTCATCCTCACCGGGTCGATCAACCTC
TGCACCGCCGAGAGCGGGCTCAGCGAAGCCGCCAAGGACCTGCTGCCGAACCTCGACGTG
CACGACACCGCGTACGCCCCGCACGGTGCCCTGTTCGAACTCGGCGGCCGGGCCCGGGTG
CTGCGCAAGGGCGTGCTCTTCCATGTGCGCGCCGGAAAGCTCTACGACCTGTGGCGCACC
TACGACTCCTGGGACGCCGTGCCCGGCTGGATCCGGTCCCGGGTGGAACGCGACTACTTC
GGCGCCGGCTTCGAGGAGCTGGCGTCGCGGGTCGTCCCCGCCGGCGAGCCGGCCGACCCC
AAGCGCCGGATGGCCCTGGTCTTCCGCTGGTACTGCGCCCAGGCACAGCGCTGGGCGATC
GAGGGCACCCCGGAGCGGGTCGCGGACTACCAGGTGGCCTGCGGGCCGGCGCTGGGCGCC
TGCAACCACTGGCTGCGCGGCACCACGTACGAGGCCTGGCGTGACCGGCACGCCGACGAA
CTGGCCGACCGACTCATCACCGAAGCCGCCGAGATCGTCGGGTCCGCCGGCGTATAG
[17] at5..305
[17] AT347..601
[17] malonyl-CoA532..536
[17] er660..944
[17] at13..915
[17] AT1039..1803
[17] malonyl-CoA1594..1608
[17] er1978..2832

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [4-130]  6.60000000000002e-106 G3DSA:3.40.366.10 [196-297]  6.60000000000002e-106 G3DSA:3.40.366.10 [347-460]  2.59999999999995e-105 G3DSA:3.40.366.10 [531-623]  2.59999999999995e-105 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR004136 2-nitropropane dioxygenase, NPD (Domain)
 [660-944]  2.2e-11 PF03060
PF03060   NMO
IPR004410 Malonyl CoA-acyl carrier protein transacylase, FabD-type (Family)
 [348-624]  3.30000000000002e-93 TIGR00128
TIGR00128   FabD
IPR013785 Aldolase-type TIM barrel (Domain)
 [661-779]  1.1e-18 G3DSA:3.20.20.70 [817-914]  1.1e-18 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
IPR014043 Acyl transferase (Domain)
 [5-305]  4.5e-40 PF00698 [347-601]  3.40000000000004e-37 PF00698
PF00698   Acyl_transf_1
IPR014179 PfaD family protein (Family)
 [650-1072]  TIGR02814
TIGR02814   PfaD_fam
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [3-304]  3.70001063537244e-44 SSF52151 [344-647]  2.50000909916183e-61 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [132-194]  1.59999889349252e-11 SSF55048 [464-531]  1e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [7-300]  3.89999861795218e-54 SM00827 [349-676]  9.40003071030835e-49 SM00827
SM00827   PKS_AT
SignalP No significant hit
TMHMM No significant hit