close all open/close all

CDS information : Kirro_00320


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction92,270 / 92,689 / + [in whole cluster]
92,270 / 92,689 / + [in contig]
Location92270..92689 [in whole cluster]
92270..92689 [in contig]
TypeCDS
Length420 bp (139 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productaspartate 1-decarboxylase
aspartate alpha-decarboxylase
Product (GenBank)putative aspartate-1-decarboxylase precursor
GenekirD
panD
Gene (GenBank)kirD
EC number4.1.1.11
Keyword
  • beta-alanine
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[19609288] The kirromycin gene cluster of Streptomyces collinus Tu 365 codes for an aspartate-alpha-decarboxylase, KirD, which is involved in the biosynthesis of the precursor beta-alanine. (J Antibiot (Tokyo). , 2009)
Related Reference
ACC
Q9X4N0
PmId
[10103247] Expression of the Corynebacterium glutamicum panD gene encoding L-aspartate-alpha-decarboxylase leads to pantothenate overproduction in Escherichia coli. (Appl Environ Microbiol. , 1999)

close this sectionSequence

selected fasta
>aspartate 1-decarboxylase [putative aspartate-1-decarboxylase precursor]
MYREMLKSKIHRATVTQADLHYVGSLTLDSTLMAAANLLPGEKVDVVDIDNGARLSTYVI
EGPAGSGVVGINGAAARLISPGDLVIVISYAAMTEEQARAYRPSVVFVDDGNRPQHVGSD
PAEAPDGADDLIRGDTVDA
selected fasta
>aspartate 1-decarboxylase [putative aspartate-1-decarboxylase precursor]
GTGTACCGAGAGATGCTCAAGTCGAAGATCCACCGCGCCACCGTGACGCAGGCGGACCTG
CACTACGTCGGCTCGCTGACGCTCGACTCGACGCTGATGGCCGCCGCGAACCTGCTGCCC
GGGGAGAAGGTCGACGTCGTCGACATCGACAACGGCGCCCGGCTCAGCACGTACGTCATC
GAGGGGCCGGCCGGCAGCGGAGTGGTGGGCATCAACGGCGCGGCGGCCCGGCTGATCAGT
CCCGGCGACCTGGTGATCGTCATCTCCTACGCGGCGATGACCGAGGAACAGGCTCGCGCG
TACCGGCCGAGCGTGGTCTTCGTCGACGACGGCAACCGACCGCAGCACGTCGGTTCCGAC
CCCGCCGAGGCGCCGGACGGCGCCGACGACCTGATACGCGGCGACACCGTCGACGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003190 Aspartate decarboxylase (Family)
 [1-114]  1.6e-49 PF02261
PF02261   Asp_decarbox
 [1-127]  3.39999972437687e-72 PIRSF006246
PIRSF006246   Asp_decarbox
 [5-113]  PD009294
PD009294   Asp_decarbox
 [1-118]  3.80000000000003e-48 TIGR00223
TIGR00223   PanD
IPR009010 Aspartate decarboxylase-like fold (Domain)
 [1-118]  6.00001679190159e-47 SSF50692
SSF50692   Asp_decarb_fold
 [1-118]  3.2e-53 G3DSA:2.40.40.20
G3DSA:2.40.40.20   Asp_decarboxylase-like_fold
SignalP No significant hit
TMHMM No significant hit