close all open/close all

CDS information : Kirro_00330


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction92,721 / 93,677 / + [in whole cluster]
92,721 / 93,677 / + [in contig]
Location92721..93677 [in whole cluster]
92721..93677 [in contig]
TypeCDS
Length957 bp (318 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative methyltransferase
Product (GenBank)putative SAM-dependent methyltransferase
Gene
Gene (GenBank)kirM
EC number2.1.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
Related Reference
ACC
Q54303
NITE
Rapam_00180
PmId
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>putative methyltransferase [putative SAM-dependent methyltransferase]
MSQPDVMTAFTAGLADINLDESRAPRSGAEAAGMKSASSSIYDMAATLSGRGELWNWGMY
DPGLAAEIEARLPGFTDFGTDGFSEQLYYLALRDLPDGLDGCADRTVLEVGCGTGEGLNF
LSRLVPGARMTGLDLSPKAVARAEATLARGETLRFVQGDAEKLPFEDSSVDVLINIESSH
TYPDLGRFLHEAARVLRPGGTLSHIDVFTRQRLRTMRGITEEMPQLKWITDHDVSAEVRA
AVRRRMAPGSRFRRTLDRQRMNPLVRTIATHSQILMFGGMFAGYRPPSSVKVLSRLGLVP
WMSGLPMESYRHQVAVRV
selected fasta
>putative methyltransferase [putative SAM-dependent methyltransferase]
ATGAGCCAACCCGATGTGATGACCGCCTTCACCGCCGGTCTCGCGGACATCAACCTCGAC
GAGTCCAGAGCACCCCGCTCGGGGGCCGAGGCCGCCGGGATGAAATCCGCCAGTTCCTCC
ATCTACGACATGGCGGCCACCCTGTCCGGTCGCGGTGAGCTGTGGAACTGGGGGATGTAC
GACCCCGGTCTGGCGGCCGAGATCGAGGCCCGGCTGCCCGGGTTCACCGACTTCGGCACC
GACGGGTTCAGCGAGCAGCTCTACTACCTGGCCCTGCGCGACCTGCCCGACGGTCTGGAC
GGGTGCGCCGACCGGACGGTTCTGGAGGTGGGCTGCGGGACGGGCGAAGGGCTCAACTTC
CTGTCCCGCCTCGTCCCCGGCGCCCGGATGACCGGCCTCGACCTGTCGCCGAAGGCGGTC
GCCCGGGCCGAGGCCACGCTGGCGCGGGGTGAGACCCTGCGCTTCGTCCAGGGCGACGCC
GAGAAGCTGCCGTTCGAGGACTCCTCGGTGGATGTGCTGATCAACATCGAGAGCTCGCAC
ACGTATCCCGATCTGGGCCGCTTTCTGCACGAGGCCGCGCGGGTGCTGCGGCCGGGCGGG
ACGCTGTCGCACATCGACGTGTTCACCCGCCAGCGGCTGCGGACGATGCGGGGGATCACC
GAGGAGATGCCCCAGCTGAAGTGGATCACCGATCACGACGTCTCCGCCGAGGTCCGCGCC
GCGGTGCGCCGCCGGATGGCCCCGGGCAGCCGCTTCCGCCGCACGCTCGACCGGCAGCGG
ATGAACCCGCTGGTGCGCACGATCGCCACGCACAGTCAGATCCTGATGTTCGGCGGCATG
TTCGCCGGCTACCGGCCGCCCTCCTCGGTCAAGGTACTCAGCCGGCTCGGCCTCGTGCCG
TGGATGAGCGGCCTGCCGATGGAGAGCTACCGGCACCAGGTCGCCGTCCGAGTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [108-202]  2.8e-24 PF08241
PF08241   Methyltransf_11
SignalP
 [1-31]  0.227 Signal
Bacteria, Gram-positive   
TMHMM No significant hit