close all open/close all

CDS information : Kirro_00340


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction93,687 / 95,024 / + [in whole cluster]
93,687 / 95,024 / + [in contig]
Location93687..95024 [in whole cluster]
93687..95024 [in contig]
TypeCDS
Length1,338 bp (445 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.4 Other
Producttrans-acting acyltransferase
Product (GenBank)
Gene
Gene (GenBank)kirCII
EC number
Keyword
  • trans AT
  • ethylmalonyl-CoA
Note
Note (GenBank)
  • putative acyltransferase
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
[21513880] Supramolecular templating in kirromycin biosynthesis: the acyltransferase KirCII loads ethylmalonyl-CoA extender onto a specific ACP of the trans-AT PKS. (Chem Biol. , 2011)
[23083014] Poly specific trans-acyltransferase machinery revealed via engineered acyl-CoA synthetases. (ACS Chem Biol. , 2013)
[24726832] Reprogramming Acyl Carrier Protein Interactions of an Acyl-CoA Promiscuous trans-Acyltransferase. (Chem Biol. , 2014)
[24871074] Comparative analysis of the substrate specificity of trans- versus cis-acyltransferases of assembly line polyketide synthases. (Biochemistry. , 2014)

close this sectionPKS/NRPS Module

18 ethylmalonyl-CoA
AT91..400

close this sectionSequence

selected fasta
>trans-acting acyltransferase
MTVRLFAVAAGTEEGLLAALRGHADRIRAGRDLPTLARYCHDAAARTPGLAHRAALTADS
YDDLAEGLDKLVREWADRIPPPSPSRRPGLVFVFAGQGAQWDGMGLELLDTEPVFGAALR
RCDERVRELAGFSVIQQLRAGPAMSRLGEIDVLQPTMVSLQIALVALWRSWRVEPDAVTG
HSMGEISAGYAAGALTLDDALLIACRRSALLRRIAGRGALATTELSPEAAHALAASSGGR
ICVAGENSPRSTVLAGDTATLTALVEDLDRRGVYCRMVRGTVASHSHYVDELRDDLAGAL
RPLSPVPSRVPFYSTVTAAPVPGTDLGPAYWMRNLREPVRLAAATGRLAEDGHEIFVEVS
THPVLLSSLRQTLESAGRPGEVLPSGRRRTERRAMLSSLGTLFTYGRDPHWPTSAPPAPA
LTPYQAAVLAAVRRPRPSPAAAGSG
selected fasta
>trans-acting acyltransferase
GTGACCGTACGGCTGTTCGCCGTCGCCGCCGGGACCGAGGAGGGCCTGCTCGCCGCCCTC
CGCGGGCACGCGGACCGGATCCGCGCCGGCCGGGACCTGCCCACGCTGGCCCGGTACTGC
CACGACGCGGCAGCCAGGACACCCGGTCTGGCCCACCGGGCCGCTCTCACCGCCGATTCC
TACGACGACCTCGCCGAGGGCCTGGACAAGCTGGTACGGGAGTGGGCCGACCGGATACCG
CCTCCGTCGCCGTCCCGGCGGCCGGGACTGGTGTTCGTCTTCGCCGGCCAGGGCGCCCAG
TGGGACGGCATGGGCCTGGAACTGCTCGACACCGAGCCGGTGTTCGGCGCGGCGCTGCGG
CGCTGCGACGAACGGGTACGCGAGCTGGCCGGCTTCTCGGTGATCCAGCAGTTGCGGGCC
GGCCCGGCGATGTCGCGGCTCGGTGAGATCGACGTGCTGCAGCCGACGATGGTGTCGTTG
CAGATCGCCCTGGTGGCCCTGTGGCGCAGTTGGCGGGTGGAGCCGGACGCGGTGACCGGG
CACAGCATGGGCGAGATCTCCGCCGGGTACGCGGCCGGAGCGCTCACCCTCGACGACGCC
CTGCTGATCGCCTGCCGTCGCAGCGCCCTGCTGCGGCGGATCGCCGGCCGGGGCGCGCTG
GCCACCACCGAGCTGTCGCCCGAGGCCGCGCACGCCCTGGCCGCCTCCAGCGGAGGCCGT
ATCTGCGTCGCCGGGGAGAACAGTCCCCGCTCGACCGTGCTGGCCGGGGACACCGCCACG
CTGACGGCGCTGGTCGAGGACCTCGATCGGCGCGGCGTCTACTGCCGGATGGTGCGGGGT
ACGGTCGCCTCGCACAGCCACTACGTCGACGAACTGCGCGACGACCTGGCTGGGGCGCTG
CGCCCGCTGAGCCCGGTGCCGTCACGGGTGCCGTTCTACTCGACCGTGACCGCGGCGCCG
GTCCCCGGCACCGACCTGGGGCCCGCGTACTGGATGCGCAACCTCCGGGAGCCGGTCCGG
CTGGCCGCCGCCACCGGCCGGCTGGCCGAGGACGGTCATGAGATCTTCGTCGAGGTGAGC
ACCCATCCGGTGCTGCTCTCCAGCCTGCGGCAGACGCTGGAGAGCGCCGGACGGCCGGGG
GAGGTGCTGCCCTCCGGCCGCCGGCGGACCGAACGCCGGGCCATGCTGTCGTCGCTCGGC
ACGCTGTTCACCTACGGCCGCGACCCGCACTGGCCGACGTCCGCCCCGCCGGCGCCGGCG
CTCACTCCCTACCAGGCCGCCGTCCTGGCGGCCGTCCGGCGCCCGCGGCCCTCGCCGGCC
GCGGCGGGGTCAGGATGA
[18] AT91..400
[18] ethylmalonyl-CoA282..286
[18] AT271..1200
[18] ethylmalonyl-CoA844..858

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [84-214]  2.20000000000002e-69 G3DSA:3.40.366.10 [282-393]  2.20000000000002e-69 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR014043 Acyl transferase (Domain)
 [91-400]  1.60000000000002e-87 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [89-378]  6.99997659850661e-62 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [216-281]  5.40000570248859e-11 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [93-390]  1.69998802370953e-93 SM00827
SM00827   PKS_AT
SignalP No significant hit
TMHMM No significant hit