close all open/close all

CDS information : Kirro_00350


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction95,573 / 95,016 / - [in whole cluster]
95,573 / 95,016 / - [in contig]
Locationcomplement(95016..95573) [in whole cluster]
complement(95016..95573) [in contig]
TypeCDS
Length558 bp (185 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)kirHII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTPETFTVLLSDSAVRRVFSAVALGSSTSAEILAATGLAAPEAAPAIGRLLREGLVVPRG
RGRLAVDEAALGAAAEIAGRRLREQAEAEQPDPGLRGYVRGTVLVRLPEDDDETRRAVLD
HVAATTFEAGREYDERTVTDLLRPWCEGAAVDPVSLRRSLVDDGFLHRESGSYRLVSLVG
PGSSS
selected fasta
>hypothetical protein [hypothetical protein]
ATGACGCCCGAGACATTCACCGTTCTCCTTTCCGACTCCGCTGTTCGGCGGGTTTTCTCG
GCCGTGGCCCTGGGCTCGTCGACCTCCGCGGAGATCCTCGCCGCGACCGGGCTCGCGGCC
CCGGAGGCCGCCCCGGCCATCGGCCGGCTGCTGCGCGAGGGCCTGGTCGTCCCCCGGGGC
CGGGGCCGGCTGGCGGTCGACGAGGCCGCCCTGGGTGCCGCGGCCGAGATCGCCGGACGC
CGTCTGCGGGAGCAGGCGGAGGCCGAACAGCCCGATCCCGGGCTGCGCGGCTACGTCCGT
GGCACGGTGCTGGTCCGGTTGCCGGAGGACGACGACGAGACCCGGCGGGCGGTGCTGGAC
CATGTGGCGGCGACGACCTTCGAGGCCGGTCGGGAGTACGACGAACGCACCGTGACCGAT
CTGCTGCGGCCGTGGTGCGAGGGCGCCGCCGTGGACCCGGTCTCGCTGCGGCGGTCCCTG
GTCGACGACGGGTTCCTGCACCGCGAGTCCGGGTCCTACCGGCTCGTCTCCCTCGTGGGG
CCCGGCTCGTCATCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR018656 Domain of unknown function DUF2087 (Domain)
 [105-175]  1.1e-12 PF09860
PF09860   DUF2087
SignalP
 [1-30]  0.599 Signal
Eukaryota   
 [1-34]  0.374 Signal
Bacteria, Gram-positive   
TMHMM No significant hit