close all open/close all

CDS information : Kirro_00360


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction95,902 / 95,570 / - [in whole cluster]
95,902 / 95,570 / - [in contig]
Locationcomplement(95570..95902) [in whole cluster]
complement(95570..95902) [in contig]
TypeCDS
Length333 bp (110 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)kirHIII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MPRKSYQVIVYGKFAPLDDDQRAKLLAVADQHDLFHSKFTEEGTVTYERTLLTFTFRCAV
KADAEDKTEKVVAGVEELATAAVRGLGADVRDLRSVCTDLETIKIKRRGR
selected fasta
>hypothetical protein [hypothetical protein]
ATGCCCCGCAAGAGTTATCAGGTCATCGTCTACGGCAAGTTCGCGCCGCTCGACGACGAC
CAGCGCGCCAAGCTGCTGGCCGTGGCCGACCAGCACGACCTGTTCCACTCGAAGTTCACC
GAGGAGGGCACGGTCACCTACGAGCGGACCCTGCTCACCTTCACCTTCCGCTGTGCCGTG
AAGGCCGACGCCGAGGACAAGACCGAGAAGGTCGTCGCCGGGGTCGAGGAACTGGCCACG
GCCGCCGTCCGCGGCCTCGGCGCCGATGTGCGCGATCTGCGGTCCGTCTGCACCGACCTG
GAGACCATCAAGATCAAGCGGCGGGGACGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit