close all open/close all

CDS information : Kirro_00370


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction96,856 / 95,954 / - [in whole cluster]
96,856 / 95,954 / - [in contig]
Locationcomplement(95954..96856) [in whole cluster]
complement(95954..96856) [in contig]
TypeCDS
Length903 bp (300 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter(fragment)
Product (GenBank)putative major facilitator family transporter
Gene
Gene (GenBank)kirTI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
Related Reference
ACC
P46105
NITE
Actino_00140
PmId
[1878971] The act cluster contains regulatory and antibiotic export genes, direct targets for translational control by the bldA tRNA gene of Streptomyces. (Cell. , 1991)
[8636024] Production of actinorhodin-related "blue pigments" by Streptomyces coelicolor A3(2). (J Bacteriol. , 1996)
[17644591] Investigation of transcription repression and small-molecule responsiveness by TetR-like transcription factors using a heterologous Escherichia coli-based assay. (J Bacteriol. , 2007)
[17338074] Initiation of actinorhodin export in Streptomyces coelicolor. (Mol Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative drug resistance transporter(fragment) [putative major facilitator family transporter]
MASVPVLVAFVYYERYKTAKDGSPLVVLSLFRIRTFGAGVGAQLLFSCIPAGFFLSWTLY
LQGGLGWSALHTGLTAIPFSLGVPIAGNLAVRKLFPLYGRKCLFGGALLMMAGLLLYAWI
ADRAGDGITSWHAVVPMLLLGSGMGMLLAPLTGMTLNDVEPREAGAASGLINAAGQLGAA
LGVAIIGAIFFSGLAANAGTQADRVLPSVPAVASQQAGIRACAVDSHDQADLTAVPDSCR
ALGTEDPARQKAIGNALTDINSRTFTATFSEALYWASAGLAAVICLLFLLPRQPRRLGVS
selected fasta
>putative drug resistance transporter(fragment) [putative major facilitator family transporter]
GTGGCCTCCGTACCGGTCCTCGTGGCGTTCGTGTACTACGAGCGGTACAAGACCGCCAAG
GACGGGTCGCCCCTGGTCGTCCTCTCCCTCTTCAGGATCCGGACCTTCGGGGCCGGGGTC
GGCGCACAACTGCTCTTCAGCTGCATCCCGGCCGGCTTCTTCCTCAGCTGGACGCTCTAC
CTGCAGGGCGGTCTGGGCTGGTCGGCGCTGCACACCGGTCTCACCGCGATCCCGTTCTCG
TTGGGCGTCCCGATCGCCGGCAACCTCGCCGTCCGCAAACTCTTCCCCCTCTACGGACGC
AAGTGCCTGTTCGGCGGGGCGCTGCTGATGATGGCCGGGCTCCTGCTGTACGCGTGGATC
GCCGACCGGGCGGGCGACGGGATCACCTCCTGGCACGCCGTCGTCCCGATGCTGCTGCTC
GGCTCCGGCATGGGCATGCTGCTGGCCCCGCTGACCGGCATGACCCTGAACGACGTCGAG
CCGCGGGAGGCCGGCGCGGCGTCCGGCCTGATCAACGCGGCCGGTCAGCTCGGCGCCGCC
CTCGGCGTGGCCATCATCGGCGCGATCTTCTTCTCCGGCCTCGCCGCCAACGCGGGCACG
CAGGCCGACCGGGTGCTGCCGAGCGTCCCGGCCGTCGCCTCGCAGCAGGCCGGGATCCGC
GCCTGCGCCGTCGACTCCCACGACCAGGCCGACCTCACCGCCGTGCCCGACTCCTGCCGC
GCCCTCGGAACCGAGGACCCCGCCCGGCAGAAGGCGATCGGGAACGCCCTGACCGACATC
AACTCCAGGACGTTCACGGCCACCTTCAGCGAAGCCCTCTACTGGGCGTCCGCGGGCCTG
GCCGCGGTGATCTGCCTGCTGTTCCTGCTGCCGCGGCAACCGCGGCGGCTGGGAGTGTCC
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [22-182]  9.60000000000001e-14 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [6-300]  6.19998763505952e-24 SSF103473
SSF103473   MFS_gen_substrate_transporter
SignalP
 [1-42]  0.342 Signal
Bacteria, Gram-positive   
TMHMM
 [37-59]  Transmembrane (i-o) [69-91]  Transmembrane (o-i) [103-120]  Transmembrane (i-o) [135-157]  Transmembrane (o-i) [169-191]  Transmembrane (i-o) [272-291]  Transmembrane (o-i)
Transmembrane 6