close all open/close all

CDS information : Kirro_00390


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction97,990 / 97,676 / - [in whole cluster]
97,990 / 97,676 / - [in contig]
Locationcomplement(97676..97990) [in whole cluster]
complement(97676..97990) [in contig]
TypeCDS
Length315 bp (104 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator(fragment)
Product (GenBank)putative TetR family transcriptional regulator
Gene
Gene (GenBank)kirRI
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator(fragment) [putative TetR family transcriptional regulator]
MRDPAVLSVLADRERRSREAMAQALAQGFAARSVTPPAPVELLALIVHALDDGLSIQRVL
SAGESPAGGVMDVVDLLMRSWTALARAGTPEATDPPASEGGATP
selected fasta
>putative TetR family transcriptional regulator(fragment) [putative TetR family transcriptional regulator]
ATGCGCGATCCGGCGGTGTTGTCGGTGCTGGCCGACCGTGAGCGCCGTTCCCGCGAGGCG
ATGGCCCAGGCCCTCGCGCAGGGTTTCGCCGCACGGTCGGTCACCCCGCCCGCGCCGGTG
GAGCTGCTCGCCCTGATCGTGCACGCCCTGGACGACGGGCTCTCCATCCAGCGCGTGCTC
TCGGCCGGCGAGAGCCCGGCCGGGGGCGTCATGGACGTGGTGGATCTGCTGATGCGGTCG
TGGACCGCGCTGGCCCGCGCCGGAACCCCCGAAGCCACCGATCCGCCCGCCTCTGAGGGC
GGCGCCACTCCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [2-82]  4.89999951782359e-10 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [2-79]  2.4e-06 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit