close all open/close all

CDS information : Kirro_00410


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction98,503 / 99,720 / + [in whole cluster]
98,503 / 99,720 / + [in contig]
Location98503..99720 [in whole cluster]
98503..99720 [in contig]
TypeCDS
Length1,218 bp (405 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative cytochrome P450
Product (GenBank)putative cytochrome P450 hydroxylase
Gene
Gene (GenBank)kirOII
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)
Related Reference
ACC
Q00441
PmId
[2011746] An erythromycin derivative produced by targeted gene disruption in Saccharopolyspora erythraea. (Science. , 1991)
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)
[7749919] Structure of cytochrome P450eryF involved in erythromycin biosynthesis. (Nat Struct Biol. , 1995)

close this sectionSequence

selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
MTGTFDWTDVEFDLSDVNFVTDREAGERWTGAPRPVCPGRFSDGADVYVVTRYEAVRSLF
ADRRVSNHPPEGVHLDSMRRRGVPEELLKYFDSTIMTMVPEDHRRVRSLIDRAFSVRRVK
SLRPRIERLADQLLDQMDPEGETDLVAGYAHPISTTVICELLGVDDEYRDQWLKWSEAFT
TFVRPDPEILPPALHGMVDTVIRLIGARRAQPGDDLISDLVQISDETEKLDEVELVALVL
VLVQAGLDTVRHSISLSFFNLLVHPDQLELVKSHPENTVQAVRELMRYSGPIKMALPRFA
AEPIEIDGVTIPKDGQIQLVVGAANNDPERFTDPRVLDVTRADNPQLSFAAGDHFCPGAS
LATAETEIALNKLFARYPDVRLAADPDEVGPRFLKAVTRLPVQLV
selected fasta
>putative cytochrome P450 [putative cytochrome P450 hydroxylase]
GTGACCGGAACATTCGATTGGACGGACGTCGAGTTCGACCTGTCCGACGTCAACTTCGTG
ACCGACCGCGAGGCGGGGGAGCGCTGGACAGGCGCGCCCCGGCCGGTGTGCCCGGGCCGC
TTCTCCGACGGCGCCGACGTCTACGTCGTCACCCGTTACGAGGCGGTCCGCAGCCTCTTC
GCCGATCGCCGGGTCAGCAACCACCCGCCGGAGGGCGTCCACCTCGACAGCATGCGCCGT
CGCGGCGTGCCCGAGGAACTGCTCAAGTACTTCGACTCGACGATCATGACGATGGTGCCG
GAGGACCACCGGCGCGTGCGCTCCCTGATCGACCGGGCGTTCTCGGTGCGCCGGGTCAAG
TCCCTGCGCCCCCGGATCGAGCGGCTCGCGGACCAGTTGCTCGACCAAATGGACCCCGAA
GGCGAGACGGACCTCGTCGCCGGGTACGCCCACCCGATCTCCACCACGGTCATCTGCGAA
CTCCTCGGCGTCGACGACGAGTACCGCGACCAGTGGCTGAAGTGGTCCGAGGCGTTCACC
ACCTTCGTCCGCCCCGACCCGGAGATCCTGCCGCCCGCGCTCCACGGCATGGTCGACACG
GTCATCCGGCTGATAGGCGCGCGCCGCGCCCAGCCCGGCGACGACCTGATCTCCGACCTG
GTCCAGATCAGCGACGAGACCGAGAAGCTCGACGAGGTCGAACTCGTCGCCCTGGTCCTG
GTCCTGGTGCAGGCCGGCCTCGACACCGTCCGGCACTCGATCTCGCTCAGCTTCTTCAAC
CTCCTGGTCCACCCCGACCAGCTGGAGCTGGTCAAGTCGCACCCGGAGAACACCGTCCAG
GCGGTCCGCGAGCTGATGCGCTACTCCGGTCCGATCAAGATGGCCCTGCCGCGCTTCGCC
GCGGAGCCGATCGAGATCGACGGGGTGACCATCCCCAAGGACGGCCAGATCCAGCTCGTG
GTCGGCGCCGCCAACAACGACCCTGAGCGGTTCACCGACCCGCGCGTCCTCGACGTCACC
CGCGCCGACAACCCCCAGCTCAGCTTCGCCGCCGGCGACCACTTCTGCCCGGGGGCGTCG
CTGGCCACGGCGGAGACCGAGATCGCGCTCAACAAGCTGTTCGCGCGCTACCCCGACGTG
CGCCTGGCCGCCGACCCCGACGAGGTCGGCCCGCGCTTCCTGAAAGCCGTCACACGACTG
CCCGTCCAGCTCGTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [32-404]  1.9e-91 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
 [280-377]  5.40000000000001e-15 PF00067
PF00067   p450
 [35-404]  2.19999900980707e-81 SSF48264
SSF48264   Cytochrome_P450
IPR002397 Cytochrome P450, B-class (Family)
 [98-109]  1.99999636034521e-39 PR00359 [144-160]  1.99999636034521e-39 PR00359 [161-176]  1.99999636034521e-39 PR00359 [199-221]  1.99999636034521e-39 PR00359 [280-291]  1.99999636034521e-39 PR00359 [298-325]  1.99999636034521e-39 PR00359 [326-341]  1.99999636034521e-39 PR00359 [347-356]  1.99999636034521e-39 PR00359 [356-367]  1.99999636034521e-39 PR00359
PR00359   BP450
SignalP No significant hit
TMHMM No significant hit