close all open/close all

CDS information : Kirro_00420


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction99,761 / 100,543 / + [in whole cluster]
99,761 / 100,543 / + [in contig]
Location99761..100543 [in whole cluster]
99761..100543 [in contig]
TypeCDS
Length783 bp (260 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)kirHIV
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MLQRVLGTQYLTPLREGGSLPGLVEADNDGIYVVKFRGAGQGTAALVAEIVVGELGRRLG
IRVPELVTIDIDPEMARRDPDQEIQELLRASAGENLGMDFLPGSVGYDGVGWEPPAEEAA
RIYWLDALTANVDRSWSNPNLIIWHRRLWAIDHGAALLFQHSWPAVAAWAERRYDLSQHV
LADLVATLAPAVLAKLDAELAEAVTAETLTEITALVPDSFLLGMNSVPQDADPADLRRRY
VDYLLTRCAGPRAWWPEEDA
selected fasta
>hypothetical protein [hypothetical protein]
TTGTTGCAAAGAGTATTAGGAACGCAGTACCTGACGCCCCTGCGTGAGGGCGGATCGCTG
CCCGGCCTGGTGGAGGCCGACAACGACGGCATCTACGTCGTGAAGTTCCGCGGCGCGGGC
CAGGGCACCGCGGCCCTGGTCGCGGAGATCGTCGTCGGCGAACTCGGCCGGCGACTGGGG
ATCCGTGTCCCCGAGCTCGTCACCATAGACATCGACCCGGAAATGGCGCGCCGCGACCCC
GACCAGGAGATCCAGGAGCTACTGCGGGCCAGCGCCGGCGAGAACCTGGGCATGGACTTC
CTGCCCGGGTCGGTCGGTTACGACGGGGTCGGATGGGAGCCGCCCGCCGAGGAGGCCGCC
AGGATCTACTGGCTGGACGCGCTGACCGCCAACGTCGACCGCAGCTGGTCCAACCCCAAC
CTGATCATCTGGCACCGCCGGCTCTGGGCCATCGACCACGGTGCCGCACTGCTGTTCCAG
CACTCCTGGCCGGCCGTCGCCGCCTGGGCCGAGCGCCGCTACGACCTGTCCCAGCACGTG
CTCGCCGACTTGGTCGCTACCCTCGCCCCGGCCGTTCTCGCCAAACTGGACGCCGAACTC
GCCGAGGCGGTGACCGCCGAGACGCTGACCGAGATCACCGCCCTGGTCCCGGACAGCTTC
CTGCTGGGCATGAACTCCGTGCCCCAGGACGCGGACCCCGCCGACCTGCGGCGGCGCTAC
GTGGACTATCTGCTCACCCGATGCGCCGGACCCCGCGCGTGGTGGCCGGAGGAGGACGCA
TGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP
 [1-26]  0.194 Signal
Eukaryota   
TMHMM No significant hit