close all open/close all

CDS information : Kirro_00430


close this sectionLocation

Organism
StrainTü365
Entry nameKirromycin
Contig
Start / Stop / Direction100,540 / 100,935 / + [in whole cluster]
100,540 / 100,935 / + [in contig]
Location100540..100935 [in whole cluster]
100540..100935 [in contig]
TypeCDS
Length396 bp (131 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
Gene
Gene (GenBank)kirHV
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[18291322] Molecular analysis of the kirromycin biosynthetic gene cluster revealed beta-alanine as precursor of the pyridone moiety. (Chem Biol. , 2008)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTTATPSLLGFDYALLRAVPRVDRSERINVGALLYCPGADFLGAAIHVDADRLRALDPDI
DIEMVTAALDTIRAVCAGGPEGGPAGSGTRGARFGWLTAPRSTVIQTSPVHGGLTTDPAA
ELKRLMGRLVH
selected fasta
>hypothetical protein [hypothetical protein]
ATGACCACCGCCACGCCGTCCCTCCTCGGCTTCGACTACGCCCTGCTGCGCGCCGTCCCG
CGAGTCGACCGCAGCGAGCGGATCAACGTCGGGGCGCTGCTCTACTGCCCCGGCGCCGAC
TTCCTCGGCGCCGCGATCCACGTCGACGCCGACCGGCTTCGCGCGCTGGACCCCGACATC
GACATCGAGATGGTCACGGCGGCCCTGGACACCATCCGCGCGGTGTGCGCGGGCGGCCCC
GAGGGCGGTCCCGCCGGGTCCGGCACGCGCGGGGCGCGCTTCGGCTGGCTCACCGCACCC
CGCAGCACCGTGATCCAGACCAGTCCCGTGCACGGCGGACTCACCACCGATCCGGCCGCC
GAACTCAAGCGCCTGATGGGACGGCTCGTGCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR021398 Protein of unknown function DUF3037 (Family)
 [13-130]  5.59999999999999e-39 PF11236
PF11236   DUF3037
SignalP
 [1-25]  0.223 Signal
Eukaryota   
TMHMM No significant hit